PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g060490.2.1
Common NameLOC101265163
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family GATA
Protein Properties Length: 172aa    MW: 18569.7 Da    PI: 8.5827
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g060490.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.52.1e-1968101134
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                         C+nCg+ kTplWR+gp g+k+LCnaCG++ rkk+
  Solyc01g060490.2.1  68 CVNCGAMKTPLWRSGPAGPKSLCNACGIRSRKKK 101
                         ********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.6116298IPR000679Zinc finger, GATA-type
SMARTSM004012.6E-1262112IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.75E-1365102No hitNo description
Gene3DG3DSA:3.30.50.103.6E-1667102IPR013088Zinc finger, NHR/GATA-type
PROSITE patternPS0034406893IPR000679Zinc finger, GATA-type
PfamPF003201.1E-1668102IPR000679Zinc finger, GATA-type
CDDcd002023.72E-1468102No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MDLTDKVIGS EATEMTTPEV MISSEMEVKA AEMMISPEIK AKAPEVISSE IQMKTPEVIS  60
SEIQMKNCVN CGAMKTPLWR SGPAGPKSLC NACGIRSRKK KRDLLGLNKD EKKTKKSSAN  120
SASSSNVDKK KKKKICAVKN ADAIPIHWTD LDDVEQAAFL LMCLSCSSVC A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010318767.11e-120PREDICTED: GATA transcription factor 16
TrEMBLK4AWF21e-120K4AWF2_SOLLC; Uncharacterized protein
STRINGSolyc01g060490.2.11e-120(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
AsteridsOGEA19992362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49300.12e-19GATA transcription factor 16
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]