PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g021730.2.1
Common NameLOC101264245
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 266aa    MW: 30369.1 Da    PI: 6.7799
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g021730.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM73.84.2e-2351392128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleev.ikevdiy.kvePwdLpk.....kvka..eek..ewy.fFskrdkkyatgkrknr.atk 79 
                           GfrF+Ptd e v  +L + ++gk ++ + +  ++vd y k ePwd+ +     +  +  e++  + y fF+++ kk+ +++r +r + +
  Solyc01g021730.2.1   5 KEGFRFSPTDAEAV-TFLLRFIAGKFMNDSGFiTTHVDTYgKQEPWDIYShgvacS--NddEDNdcSQYrFFITKLKKK-SESRYSRdVGN 91 
                         68************.8999999999988878835566877367*****73356541..222333343352666666655.56788886889 PP

                 NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +g Wk++ k+k+v +k+g ++g kk++ + + +  + ++ dW+m+ey+l
  Solyc01g021730.2.1  92 KGSWKQQDKSKSVRRKGGPVIGYKKSMSYMN-KGYNKKNGDWLMKEYTL 139
                         *****************************94.5555589********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-214161IPR003441NAC domain
PROSITE profilePS5100525.0344162IPR003441NAC domain
PfamPF023653.0E-146139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MGNLKEGFRF SPTDAEAVTF LLRFIAGKFM NDSGFITTHV DTYGKQEPWD IYSHGVACSN  60
DDEDNDCSQY RFFITKLKKK SESRYSRDVG NKGSWKQQDK SKSVRRKGGP VIGYKKSMSY  120
MNKGYNKKNG DWLMKEYTLP EYLLDKFDKD CRDYVLCSIK KRTRSKTQTK EKLKLVNIVP  180
EESTNLEDQS SATVGSTSFT EELQGRGVDA GGYLPQLELQ NEMHEGTSIF VETLPAPFTF  240
EPTSMLDFDY QYLPADFDFL RSITA*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g021730.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2459780.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-3l17 map 1, complete sequence
GenBankAC2461930.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-27p13 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004228763.10.0NAC domain-containing protein 78-like
TrEMBLA0A3Q7ECE50.0A0A3Q7ECE5_SOLLC; Uncharacterized protein
STRINGSolyc01g021730.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA22191254
Representative plantOGRP5881218
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.11e-12NAC domain containing protein 60
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]