PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g016770.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 56aa    MW: 6290.3 Da    PI: 7.4204
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g016770.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.22.9e-11750247
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                        g ++++E+ +++d++  lG++  + Ia++++ gRt++++ ++++++
  Solyc01g016770.1.1  7 GCFSEQEECIIIDLHIILGSR-RSQIAKHLP-GRTDNEVTNFLNSF 50
                        789******************.*********.**********9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.045155IPR017930Myb domain
SuperFamilySSF466893.43E-8250IPR009057Homeodomain-like
SMARTSM007171.5E-5553IPR001005SANT/Myb domain
PfamPF002491.4E-7749IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-12849IPR009057Homeodomain-like
CDDcd001674.26E-8946No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 56 aa     Download sequence    Send to blast
MPDLKMGCFS EQEECIIIDL HIILGSRRSQ IAKHLPGRTD NEVTNFLNSF ITKKT*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Germinating seed and apical meristem of shoot and root.
Functional Description ? help Back to Top
Source Description
UniProtPossible transcription activator in response to an external signal. May be involved in the regulation of flavonoid biosynthesis.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g016770.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004232612.16e-21transcription factor MYB86-like
SwissprotP200271e-19MYB3_HORVU; Myb-related protein Hv33
TrEMBLA0A3Q7EBV84e-33A0A3Q7EBV8_SOLLC; Uncharacterized protein
STRINGSolyc01g016770.1.17e-34(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2613322
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12720.13e-21myb domain protein 67
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]