PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g014480.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 676aa    MW: 76072.6 Da    PI: 6.4035
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g014480.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3417.31.7e-127384011350
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         eel++rmwkd+++lkrlker+k    +++ a++++k++++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++
  Solyc01g014480.2.1  38 EELERRMWKDRVKLKRLKERQKIA--AQQ-AAEKQKNKQTTDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNI 125
                         8*******************9964..455.599********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWkekv+fd+ngpaai+ky+a++   +++ s+  ++ + ++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWP+G+++ww 
  Solyc01g014480.2.1 126 RAWWKEKVKFDKNGPAAIAKYEAECHSKGEGISN--QNGNPQSVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVSPPWWPSGNDEWWV 214
                         *********************9988766655555..67999999*********************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX.....X CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss.....s 266
                         ++gl+k q+ ppykkphdlkk++kv+vLtavikhmsp+i++ir+l+rqsk+lqdkm+akes ++l+vl++ee+ ++    +  ss      
  Solyc01g014480.2.1 215 KMGLPKGQK-PPYKKPHDLKKMFKVGVLTAVIKHMSPDIAKIRRLVRQSKCLQDKMTAKESSIWLAVLSREESTIRLQTNDngSSsiseaP 304
                         *********.9**************************************************************997666666633566664 PP

                         XXX..XXXXXXXXXXXXXXXX.......XXXXXX.XXXXXXXXXX.................XXXXXXXXXXXXXXXXXXXXX......XX CS
                EIN3 267 lrk..qspkvtlsceqkedve.......gkkeskikhvqavktta.................gfpvvrkrkkkpsesakvsskevsrtcqs 331
                         +r   +++k  +++++++dv+                   +++++                 +++   +r+++++ ++  +    +++  s
  Solyc01g014480.2.1 305 IRGhgDKKKSSVDSDSDYDVDdvnvsvsS----------RDERRNepldarpltdvpqshqsKEQGDGQRRRRKRARSNFQ---QTQLSPS 382
                         44434566666666677777743333321..........222222356667777677666443333334433333333333...3478888 PP

                         XXXXX.XXXXXXXXXXXXX CS
                EIN3 332 sqfrgsetelifadknsis 350
                         +q ++   ++ ++d+n+ +
  Solyc01g014480.2.1 383 EQQPYDVARNSLPDMNNAN 401
                         8888888999999998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048734.4E-12438285No hitNo description
Gene3DG3DSA:1.10.3180.107.2E-69160290IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167688.63E-60166288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MAVMDEIGID ISSDIEVDDI RCDNIAEKDV SDEEIDPEEL ERRMWKDRVK LKRLKERQKI  60
AAQQAAEKQK NKQTTDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
SSDNIRAWWK EKVKFDKNGP AAIAKYEAEC HSKGEGISNQ NGNPQSVLQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGV SPPWWPSGND EWWVKMGLPK GQKPPYKKPH DLKKMFKVGV  240
LTAVIKHMSP DIAKIRRLVR QSKCLQDKMT AKESSIWLAV LSREESTIRL QTNDNGSSSI  300
SEAPIRGHGD KKKSSVDSDS DYDVDDVNVS VSSRDERRNE PLDARPLTDV PQSHQSKEQG  360
DGQRRRRKRA RSNFQQTQLS PSEQQPYDVA RNSLPDMNNA NAQFSGYIAN ESQPENNMMV  420
PRKSVERNSE GQSDLPLEES NLPMVPSANA VSTEETFVGN GPSIYPMLEN SEVVPYESRF  480
HLGTQDSVVQ RQLHDTQLQS RPQFSGMNNE PPNSIFHYGP PNNGLHNGSQ SSVLHHELQY  540
SGFTHGSQYS NLHKPTVYQY FTPSAEFGSA HEEQQSHLAF GQPQIKPQDS GVRSAVLHGD  600
RNGMSREDHH YGKDAFQNDH DRPAEMHFAS PITSGSPDYA RLSSPFNFEL DVPSPLDTGD  660
LELFLDEDVM TFFAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-711652899133ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00649PBMTransfer from LOC_Os09g31400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g014480.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2462480.0Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-65c18 map 1, complete sequence
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019069840.10.0ETHYLENE INSENSITIVE 3-like 3 protein isoform X2
SwissprotO231161e-175EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A3Q7EB470.0A0A3Q7EB47_SOLLC; Uncharacterized protein
STRINGSolyc01g014480.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Representative plantOGRP5631682
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-156ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  3. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  4. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  5. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]