PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g009650.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MYB_related
Protein Properties Length: 92aa    MW: 10497.2 Da    PI: 10.4395
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g009650.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.49.3e-151764148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++ Ed++l+d++ ++G  +W++++   g+ Rt+k+c++rw +yl
  Solyc01g009650.1.1 17 KGLWSPYEDQKLKDYILKHGHVCWASVPINAGLQRTGKSCRLRWINYL 64
                        678*****************99************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-221267IPR009057Homeodomain-like
PROSITE profilePS5129422.1731268IPR017930Myb domain
SMARTSM007175.3E-101666IPR001005SANT/Myb domain
PfamPF002492.3E-131764IPR001005SANT/Myb domain
SuperFamilySSF466892.19E-181991IPR009057Homeodomain-like
CDDcd001673.17E-92064No hitNo description
Gene3DG3DSA:1.10.10.605.9E-66891IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 92 aa     Download sequence    Send to blast
MGCKQIDKSK PKQKHKKGLW SPYEDQKLKD YILKHGHVCW ASVPINAGLQ RTGKSCRLRW  60
INYLRPGLKR GTFSTDEEEA ILTFHGMLGN K*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed at very low level. Expressed in cauline leaves. {ECO:0000269|PubMed:11581165}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that promotes photomorphogenesis in the light by participating in the transmission of phytochrome A (phyA) signals to downstream responses (PubMed:11581165, PubMed:19482971). Probably acts by activating expression of light-induced genes. In darkness, its degradation prevents the activation of light-induced genes (PubMed:11581165). {ECO:0000269|PubMed:11581165, ECO:0000269|PubMed:19482971}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g009650.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By hormones or elicitors treatment. By exposure to abiotic stress. {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4261741e-07Lycopersicon esculentum blind mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004228860.12e-62transcription factor LAF1-like
SwissprotQ9M0K44e-38LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A2G3DGB14e-52A0A2G3DGB1_CAPCH; Transcription factor MYB86
STRINGSolyc01g009650.1.11e-62(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.12e-40myb domain protein 18
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  2. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]