PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc01g008980.2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 147aa    MW: 16689.9 Da    PI: 9.8082
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc01g008980.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.51.1e-1678135462
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                         ++r rrk+kNRe+A rsR+RK+a+  eL +kv  Le+eN++Lkke +el+++ ++l se
  Solyc01g008980.2.1  78 DRRLRRKIKNRESAARSRARKQAYHNELVNKVSHLEEENMKLKKE-KELENMLSELSSE 135
                         6899***************************************76.8999999999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.5E-1375134IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.7677122IPR004827Basic-leucine zipper domain
PfamPF001706.7E-1478134IPR004827Basic-leucine zipper domain
CDDcd147071.81E-1679125No hitNo description
SuperFamilySSF579591.25E-1179125No hitNo description
Gene3DG3DSA:1.20.5.1703.1E-1479133No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MNSQERELTL GETTLEDYLV KAGLFVADAS LGHTMSLDNP TAMQNFVPPI GLSPSPSLSD  60
TPVSDRKRGA MDIDKTIDRR LRRKIKNRES AARSRARKQA YHNELVNKVS HLEEENMKLK  120
KEKELENMLS ELSSEPRYQL RRTTSF*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc01g008980.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019069565.11e-103LOW QUALITY PROTEIN: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9C5Q29e-27AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3
TrEMBLM1C2P83e-98M1C2P8_SOLTU; Uncharacterized protein
STRINGSolyc01g008980.2.11e-103(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA125961619
Representative plantOGRP5401580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G41070.33e-12bZIP family protein
Publications ? help Back to Top
  1. Haas BJ, et al.
    Full-length messenger RNA sequences greatly improve genome annotation.
    Genome Biol., 2002. 3(6): p. RESEARCH0029
    [PMID:12093376]
  2. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]
  3. Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC
    Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription.
    Plant Cell Rep., 2016. 35(1): p. 155-66
    [PMID:26441053]
  4. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]