PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc00g196060.2.1
Common NameARF6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ARF
Protein Properties Length: 354aa    MW: 39768.9 Da    PI: 9.4499
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc00g196060.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B333.19.7e-1118595699
                        TTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                  B3 56 sgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99
                        ++r++lt+GW+ Fv+a++L +gD+v+F   ++++ +l+++++r+
  Solyc00g196060.2.1 18 PKRHLLTTGWSVFVSAKRLVAGDSVIFI--WNENNQLLLGIRRA 59
                        679*************************..7888889****997 PP

2Auxin_resp115.35.4e-3884167183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalk.vkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         aahaa+t+s F++++nPra++seFv++++k+ ka++ ++vsvGmRf+m fete+ss rr++Gt++g+ dldpvrWpnS+W+s+k
  Solyc00g196060.2.1  84 AAHAAATNSRFTIFFNPRACPSEFVIPLAKYAKAVYhTRVSVGMRFRMLFETEESSIRRYMGTITGIGDLDPVRWPNSHWQSVK 167
                         79*********************************9789*****************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508639.573160IPR003340B3 DNA binding domain
SuperFamilySSF1019366.02E-131687IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-151773IPR015300DNA-binding pseudobarrel domain
PfamPF023623.0E-81759IPR003340B3 DNA binding domain
CDDcd100172.27E-61858No hitNo description
PfamPF065074.0E-3384166IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MYNSLCIYKG INCIICQPKR HLLTTGWSVF VSAKRLVAGD SVIFIWNENN QLLLGIRRAN  60
RPQTVLPSSV LSSDSMHIGL LAAAAHAAAT NSRFTIFFNP RACPSEFVIP LAKYAKAVYH  120
TRVSVGMRFR MLFETEESSI RRYMGTITGI GDLDPVRWPN SHWQSVKVGW DESTAGERQP  180
RVSLWEIEPL TTFPMYPSPF SLRLKRPWPP GLPSFPGLSN GDMTMNSQLP WLHGGMGDQG  240
IQSLNFQGFG VTPFMQPRFD ASMLGLQPDI LQAMAALDSS KLANQPLMQF QHIPSTSASS  300
IQSQLLHPSN LQHTFLQGLP ENQLISQAQM LQQQLQCHQS YNTQQQQLQR QXXX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A6e-757188213388Auxin response factor 5
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Les.61440.0cell culture| flower| fruit| leaf| root
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, culms, leaves and young panicles. {ECO:0000269|PubMed:17408882}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs).
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc00g196060.2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM5946840.0Solanum lycopersicum auxin response factor 6 (ARF6) mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015061224.10.0auxin response factor 6-like isoform X1
RefseqXP_015061225.10.0auxin response factor 6-like isoform X2
SwissprotA2YG671e-148ARFQ_ORYSI; Auxin response factor 17
SwissprotQ653U31e-148ARFQ_ORYSJ; Auxin response factor 17
TrEMBLE0AD210.0E0AD21_SOLLC; Auxin response factor
STRINGSolyc00g196060.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA58592334
Representative plantOGRP8561456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30330.21e-146auxin response factor 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Wu J, et al.
    Identification, isolation and expression analysis of auxin response factor (ARF) genes in Solanum lycopersicum.
    Plant Cell Rep., 2011. 30(11): p. 2059-73
    [PMID:21735233]