PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc00g154980.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family EIL
Protein Properties Length: 297aa    MW: 33472.6 Da    PI: 8.3896
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc00g154980.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3309.31.1e-94127164353
                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSS CS
                EIN3  64 mevcnaqGfvYgiipekgkpvegasdsLraWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqh 154
                         mevc+ qGfvYgi++ekgk+v+g sdsL++WW ekv+fd+n+p+ai+k+   +l+ + e+ l+  + s    l+elqDTtl+S+Lsalmqh
  Solyc00g154980.1.1   1 MEVCKGQGFVYGIVSEKGKLVSGCSDSLQQWWMEKVRFDQNAPIAIAKS-LPKLVEE-ENMLDP-NASFMCLLEELQDTTLSSILSALMQH 88 
                         9************************************************.5567755.444444.7899999******************* PP

                         SSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHH CS
                EIN3 155 cdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfa 245
                         c ppqrrfpl++g++pPWWPtG+elw+g +gls++qg+ppy+kph lkkawkvsvL+a ikhm p++ ++r+l+ qsk lq+km+ake+ +
  Solyc00g154980.1.1  89 CIPPQRRFPLDRGLAPPWWPTGNELWCGDQGLSQEQGPPPYRKPHGLKKAWKVSVLAAIIKHMCPDLGRMRRLVNQSKNLQNKMTAKETST 179
                         ******************************************************************************************* PP

                         HHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX CS
                EIN3 246 llsvlnqeekecatvsahssslrkqspkvtlsceqkedvegkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrg 336
                         +++v+nqee+++           k  +++++s+++  +v++++e +  +   v   + ++  +krk     +   + ++v++  q+ ++++
  Solyc00g154980.1.1 180 WSKVVNQEEALL-----------KLTRSLKISTSKG-EVNKDNEDQL-DFTFVP--KMLTKDDKRK-SIIFDHDLNMEDVVYASQNMNCPQ 254
                         *********976...........4566788888855.5555555552.233333..3577777887.6777777777889*********** PP

                         .XXXXXXXXXXXXXXXX CS
                EIN3 337 setelifadknsisqne 353
                         se  l+f dkn + ++e
  Solyc00g154980.1.1 255 SELGLGFVDKNLRIEHE 271
                         ***********998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.4E-881188No hitNo description
Gene3DG3DSA:1.10.3180.109.5E-6363192IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.31E-5568191IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEVCKGQGFV YGIVSEKGKL VSGCSDSLQQ WWMEKVRFDQ NAPIAIAKSL PKLVEEENML  60
DPNASFMCLL EELQDTTLSS ILSALMQHCI PPQRRFPLDR GLAPPWWPTG NELWCGDQGL  120
SQEQGPPPYR KPHGLKKAWK VSVLAAIIKH MCPDLGRMRR LVNQSKNLQN KMTAKETSTW  180
SKVVNQEEAL LKLTRSLKIS TSKGEVNKDN EDQLDFTFVP KMLTKDDKRK SIIFDHDLNM  240
EDVVYASQNM NCPQSELGLG FVDKNLRIEH ESSCSYGKVK SDNKITKKVP MTTSLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A4e-56701926128Protein ETHYLENE INSENSITIVE 3
4zds_B4e-56701926128Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor that may be involved in the ethylene response pathway. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc00g154980.1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004253472.30.0putative ETHYLENE INSENSITIVE 3-like 4 protein, partial
SwissprotQ9LX161e-100EIL4_ARATH; Putative ETHYLENE INSENSITIVE 3-like 4 protein
TrEMBLA0A494GA220.0A0A494GA22_SOLLC; Uncharacterized protein
STRINGSolyc00g154980.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA30423178
Representative plantOGRP5631682
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10120.11e-103EIL family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Jeong HJ,Choi JY,Shin HY,Bae JM,Shin JS
    Seed-specific expression of seven Arabidopsis promoters.
    Gene, 2014. 553(1): p. 17-23
    [PMID:25261846]