PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc00g024680.1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family Dof
Protein Properties Length: 138aa    MW: 14819 Da    PI: 10.1302
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc00g024680.1.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.52.9e-3882136357
              zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 
                         e+alkcprC+stntkfCy+nnysl+qPr+fCk+CrryWt+GGalrnvPvGgg+r+
  Solyc00g024680.1.1  82 EAALKCPRCESTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRNVPVGGGCRR 136
                         6789**************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3765136IPR003851Zinc finger, Dof-type
PfamPF027012.5E-3283137IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.79885138IPR003851Zinc finger, Dof-type
PROSITE patternPS01361087123IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MVFSSIQAYL DSSNWQQAPP SNYNHDGTGA SANGGHVLRP QLQPQQQPHP NGSGGGGGGG  60
GGSIRAGSMV DRARQANVAL PEAALKCPRC ESTNTKFCYF NNYSLTQPRH FCKTCRRYWT  120
RGGALRNVPV GGGCRRXX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15262SGGGGGGGGGS
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Specific to the midveins, containing narrow procambial cell files. Expressed in procambial cells of leaf primordia, roots and embryos, prior to the completion of xylem differentiation. {ECO:0000269|PubMed:17583520}.
UniprotTISSUE SPECIFICITY: Specific to the vascular tissues (PubMed:17583520). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) form a short-range concentration gradient that peaks at protophloem sieve elements (PSE) (PubMed:30626969). {ECO:0000269|PubMed:17583520, ECO:0000269|PubMed:30626969}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Probably involved in early processes for vascular development (PubMed:17583520). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements. Triggers the transcription of HD-ZIP III genes, especially in the central domain of vascular tissue (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:17583520, ECO:0000269|PubMed:30626969}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00295DAPTransfer from AT2G37590Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSolyc00g024680.1.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin in procambium. Antagonized by the HD-ZIP III proteins and by mobile miR165 and miR166 microRNAs. {ECO:0000269|PubMed:30626969}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004253327.12e-97dof zinc finger protein DOF2.4-like
SwissprotO809289e-75DOF24_ARATH; Dof zinc finger protein DOF2.4
TrEMBLA0A178VR342e-96A0A178VR34_ARATH; DOF2.4
STRINGSolyc00g024680.1.11e-96(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.16e-77DNA binding with one finger 2.4
Publications ? help Back to Top
  1. Heyndrickx KS,Vandepoele K
    Systematic identification of functional plant modules through the integration of complementary data sources.
    Plant Physiol., 2012. 159(3): p. 884-901
    [PMID:22589469]
  2. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]