PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G524200.1.p
Common NameLOC101768133, SETIT_036519mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 336aa    MW: 36880 Da    PI: 6.5483
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G524200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.2e-18113166356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  Seita.9G524200.1.p 113 KKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWK 166
                         4568999**********************************************9 PP

2HD-ZIP_I/II127.94.2e-41112202191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ eqv++LE++Fe  +kLeperK +lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aLkr++da+k++n++L +++++L++e+
  Seita.9G524200.1.p 112 EKKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVKADNDALLSHNKKLQAEI 202
                         69**************************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-1891169IPR009057Homeodomain-like
SuperFamilySSF466891.92E-19104170IPR009057Homeodomain-like
PROSITE profilePS5007117.346108168IPR001356Homeobox domain
SMARTSM003891.3E-17111172IPR001356Homeobox domain
CDDcd000862.46E-16113169No hitNo description
PfamPF000463.3E-15113166IPR001356Homeobox domain
PRINTSPR000311.6E-5139148IPR000047Helix-turn-helix motif
PROSITE patternPS000270143166IPR017970Homeobox, conserved site
PRINTSPR000311.6E-5148164IPR000047Helix-turn-helix motif
PfamPF021836.2E-14168208IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MRPMASNGMA SSPSPFFPPN FLLQMQQTPH DHDPQEHHHH HHEHHLPPPL HPHHNPFLSS  60
SQCPSLQDFR GMAPMLGKRP MYGADVGGGD ETNGGGGVNE DELSDDGSQA GEKKRRLNVE  120
QVRTLEKNFE LGNKLEPERK LQLARALGLQ PRQVAIWFQN RRARWKTKQL EKDYDALKRQ  180
LDAVKADNDA LLSHNKKLQA EILALKGREA GSELINLNKE TEASCSNRSE NSSEINLDIS  240
RTPPSEGPMD PPPPDHQHPS SGGGGGGGMI PFYPSAGRPS GVDIDQLLHT TSVPKLEQHS  300
GGGVQGAETA SFGNLLCGVD EPPPFWPWAD HQHFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160168RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9664900.0EU966490.1 Zea mays clone 294849 homeobox-leucine zipper protein HAT7 mRNA, complete cds.
GenBankKJ7285060.0KJ728506.1 Zea mays clone pUT6811 HB transcription factor (HB102) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985543.10.0PREDICTED: homeobox-leucine zipper protein HOX21 isoform X2
SwissprotQ8S7W91e-149HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLK4ACB20.0K4ACB2_SETIT; Uncharacterized protein
STRINGSi036519m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-77HD-ZIP family protein