PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G511500.1.p
Common NameLOC101785512, SETIT_036724mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 314aa    MW: 34357.8 Da    PI: 4.5133
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G511500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.27.9e-2069121456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         ++++  eq+++Le++Fe +++++ ++++++A+ lgL+ rqV vWFqNrRa++k
  Seita.9G511500.1.p  69 KRRLAMEQVRALERCFETDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWK 121
                         557899**********************************************9 PP

2HD-ZIP_I/II127.55.6e-4167159193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ eqv++LE++Fe+++kL+p+rK+++ar+LglqprqvavWFqnrRAR+ktk lE+d++aL++++dal+++ ++L++++++L++e+
  Seita.9G511500.1.p  67 EKKRRLAMEQVRALERCFETDNKLDPDRKARIARDLGLQPRQVAVWFQNRRARWKTKTLERDFAALRARHDALRADCDALRRDKDALAAEI 157
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         +e
  Seita.9G511500.1.p 158 RE 159
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.13E-1865123IPR009057Homeodomain-like
SMARTSM003891.2E-1966127IPR001356Homeobox domain
PROSITE profilePS5007116.40667123IPR001356Homeobox domain
PfamPF000464.6E-1768121IPR001356Homeobox domain
CDDcd000864.82E-1768123No hitNo description
Gene3DG3DSA:1.10.10.603.0E-2075122IPR009057Homeodomain-like
PRINTSPR000312.8E-594103IPR000047Helix-turn-helix motif
PROSITE patternPS00027098121IPR017970Homeobox, conserved site
PRINTSPR000312.8E-5103119IPR000047Helix-turn-helix motif
PfamPF021831.1E-13123164IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MKRQSKRPAS SNESTEAGEK LAFAEDEAQA LTARNMEHDD AELDDVDDDE DELAGGRAAR  60
PACGLGEKKR RLAMEQVRAL ERCFETDNKL DPDRKARIAR DLGLQPRQVA VWFQNRRARW  120
KTKTLERDFA ALRARHDALR ADCDALRRDK DALAAEIREL RQKLSSRPET AVKLEEAVAN  180
EAAEERQATV GAAVCKDGSS DSDSSVVFND VEASPYSGAA FEQPGLLGFG PPFLDTSAAT  240
TGCSPLPMFE TKWQQGPTYP YDSYKAGGGY GFTEEWLASS DVIGSDGAVS FFSEEHASSL  300
NFGWCASGTE AWE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX4699250.0JX469925.1 Zea mays subsp. mays clone UT3181 HB-type transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985408.10.0PREDICTED: homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP31e-112HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLK4ACW70.0K4ACW7_SETIT; Uncharacterized protein
STRINGSi036724m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.12e-27homeobox protein 6