PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G475900.1.p
Common NameLOC101756351, SETIT_036337mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family BBR-BPC
Protein Properties Length: 360aa    MW: 39483.7 Da    PI: 10.5433
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G475900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind352.21.1e-10713591301
           GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssia.erdaki...........rernlalsekkaavaerd..................... 57 
                         mdddgs   rn+g+ye     k nlglqlmss++ +rd+k+           + ++ a +++++ ++++                      
  Seita.9G475900.1.p   1 MDDDGSLGiRNWGFYETV---KGNLGLQLMSSVPpDRDTKPllpnggnflqhHGHHNAPHQHQHQHHTQHphhprgggggsgapsgmptep 88 
                         9*****999******988...************99**************998334444444444443333555666*************** PP

           GAGA_bind  58 ....maflqrdkalae.......rnkalverdnkllalllvensla...........salpvgvqvlsgtksidslqqlse.....pqled 121
                             m+f++++++l+        ++++ ++r+ k+l+ l+v  +             +++p+g++++ +++ +++lq+++      pq ++
  Seita.9G475900.1.p  89 pavhMDFVRNEAWLHPsqhhhqhHHQHQHPRQPKVLHHLPVGPAGHaghpghgghavHHHPTGYGMMADAHGVHTLQMMQPqaqqqPQPQP 179
                         **************984333222233445666777777777665557889******99*********999999988884333555544444 PP

           GAGA_bind 122 save.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvP 211
                         ++++  + +e++  +p+ e +++ k+++ +kkrq++++pk++k kk+kk  ++++++ ++++  +r + ++k++++v+ng++lD s++P+P
  Seita.9G475900.1.p 180 QPQDpPPPKEESMPQPLIEDHPVLKNEPPVKKRQQGRQPKSPKPKKPKK-VAAPQENGAPNKPAPRPRGPRKTVGMVINGIDLDLSRIPTP 269
                         45444445566666777777999999999999*****************.66777888877777*************************** PP

           GAGA_bind 212 vCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         vCsCtG+++qCY+WG+GGWqSaCCtt+iS+yPLP+stkrrgaRiagrKmSqgafkk+LekLa+eGy+l+np+DLk++WAkHGtnkfvtir
  Seita.9G475900.1.p 270 VCSCTGTPQQCYRWGAGGWQSACCTTSISTYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLAGEGYNLANPIDLKTFWAKHGTNKFVTIR 359
                         *****************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012269.5E-1831359IPR010409GAGA-binding transcriptional activator
PfamPF062172.8E-1231359IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MDDDGSLGIR NWGFYETVKG NLGLQLMSSV PPDRDTKPLL PNGGNFLQHH GHHNAPHQHQ  60
HQHHTQHPHH PRGGGGGSGA PSGMPTEPPA VHMDFVRNEA WLHPSQHHHQ HHHQHQHPRQ  120
PKVLHHLPVG PAGHAGHPGH GGHAVHHHPT GYGMMADAHG VHTLQMMQPQ AQQQPQPQPQ  180
PQDPPPPKEE SMPQPLIEDH PVLKNEPPVK KRQQGRQPKS PKPKKPKKVA APQENGAPNK  240
PAPRPRGPRK TVGMVINGID LDLSRIPTPV CSCTGTPQQC YRWGAGGWQS ACCTTSISTY  300
PLPMSTKRRG ARIAGRKMSQ GAFKKVLEKL AGEGYNLANP IDLKTFWAKH GTNKFVTIR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222228PKKPKKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985071.10.0PREDICTED: protein Barley B recombinant
RefseqXP_004985070.10.0PREDICTED: protein Barley B recombinant
SwissprotQ8GUC31e-154BBR_HORVU; Protein Barley B recombinant
TrEMBLK4ABT00.0K4ABT0_SETIT; Uncharacterized protein
STRINGSi036337m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22113697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01930.21e-61basic pentacysteine1