PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G416300.1.p
Common NameLOC101772544, SETIT_035682mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 449aa    MW: 49138.8 Da    PI: 5.6531
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G416300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like110.58.1e-35230284155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r+rWtpeLHe+Fv+av+qLGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  Seita.9G416300.1.p 230 KQRMRWTPELHECFVDAVNQLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQKYRT 284
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.967227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.6E-33228286IPR009057Homeodomain-like
SuperFamilySSF466893.76E-18229284IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-26230284IPR006447Myb domain, plants
PfamPF002495.1E-10232283IPR001005SANT/Myb domain
PfamPF143791.6E-25313360IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0016036Biological Processcellular response to phosphate starvation
GO:0055063Biological Processsulfate ion homeostasis
GO:0071486Biological Processcellular response to high light intensity
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 449 aa     Download sequence    Send to blast
MRNFNLRQSQ NSRVLGAMSS SLPILPNSLK ESFPRPCTPQ HIPMSRQLPD DSMPLHNGTP  60
QSDTLQPRTG VIGASYSGYS ANPLDSVSNH EAQSMVSPFI CQPSNVDVFQ SLSDNTPGAH  120
AEATWFPSSM DVLPVYTDNI AASDNQIQSG SSAMTSDEVA KQNDWWAEIM NDDWKDILDA  180
TATDSQSKAM MQPSNSIASL LAVNQSASSH SGEICPVASP PNSSNASAAK QRMRWTPELH  240
ECFVDAVNQL GGSEKATPKG VLKLMKVDGL TIYHVKSHLQ KYRTARYKPD LSEGTSEKRT  300
TTEELSLDLK TSMDLTEALR LQMEVQKRLH EQLEIQRKLQ LRIEEQGKYL QMMFEKQCKS  360
TTEVVQDPSS GDTSANPSSD PSHSANKDSS AAMDRNRIGD RPGTAELGER STKLGVKQKI  420
SEIDSDPEAA ADGGPKISLE KRRKLQDS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-31229288160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.9G416300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984500.10.0protein PHOSPHATE STARVATION RESPONSE 1
RefseqXP_004984501.10.0protein PHOSPHATE STARVATION RESPONSE 1
SwissprotB8ANX90.0PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLK4A9X60.0K4A9X6_SETIT; Uncharacterized protein
STRINGSi035682m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.11e-73phosphate starvation response 1