PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G340000.1.p
Common NameLOC101771892, SETIT_039462mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 272aa    MW: 29702.3 Da    PI: 5.2424
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G340000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.12.4e-09143187348
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +WT+ E+ l++ +   + g+ W++ +r++ + +t+ q+ s++qky+
  Seita.9G340000.1.p 143 KWTEYEHRLFLAGLPFYRGN-WNAMSREFLTSKTASQIASHYQKYR 187
                         8*****************99.************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM00717222775IPR001005SANT/Myb domain
SuperFamilySSF466896.36E-10138191IPR009057Homeodomain-like
TIGRFAMsTIGR015574.0E-10139189IPR006447Myb domain, plants
PROSITE profilePS512939.107139191IPR017884SANT domain
SMARTSM007177.8E-5140189IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-6143188IPR009057Homeodomain-like
PfamPF002493.3E-6143187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MHHDGYAAAT AAPPLTLAAS PAPAPEQEPK WTRRDDKFLE LLLFTRNTVS LHIASGIIGK  60
TPVQIHQRCT FMFAELSHVL ESLEVLTPPV WDMEIAAMAA AVEEEVVPEA VVPAAPPVAA  120
RKNSAERAVG AGGDKRNKKA AEKWTEYEHR LFLAGLPFYR GNWNAMSREF LTSKTASQIA  180
SHYQKYRNRE KQREHDNCKR ASIHDITEPG IAAAFAVSGG EAAAWKGELP RSEASARGQE  240
NEPWEPIESG EDGLSPVEEF PGEDDPGTLL T*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.9G340000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004986850.10.0transcription factor SRM1
TrEMBLK4AKN90.0K4AKN9_SETIT; Uncharacterized protein
STRINGSi039462m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP144181825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.22e-16MYB family protein