PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G319600.1.p
Common NameLOC101768524, SETIT_036966mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 278aa    MW: 30277.1 Da    PI: 8.6827
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G319600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54e-1597141347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ +++d+ +qlG+g+W+ I++ + ++Rt+ q+ s+ qky
  Seita.9G319600.1.p  97 PWTEEEHRKFLDGLRQLGKGDWRGISKGFVTTRTATQVASHAQKY 141
                         7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.78590146IPR017930Myb domain
SuperFamilySSF466898.61E-1891146IPR009057Homeodomain-like
TIGRFAMsTIGR015577.6E-1893145IPR006447Myb domain, plants
SMARTSM007172.9E-1094144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.4E-1195140IPR009057Homeodomain-like
CDDcd001673.43E-1097142No hitNo description
PfamPF002493.2E-1297141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MDRPEEENGR KVAPVVFRLF GVDVRRVADE ELDDFGNGFE LRKISSMPNL TVNSIDPVLP  60
PGEAGDGKAY ASDDLELASR QQKRRRRKAQ ERKKGIPWTE EEHRKFLDGL RQLGKGDWRG  120
ISKGFVTTRT ATQVASHAQK YFLRQTNPGK KKRRASLFDV GIADFSDDQV PSPPNSATKP  180
APTQEIIHTD RGDVPIPSYR GFGGILGNNI QVSELTNYFE RPMAHAETSF ASMASGLETA  240
SSVNSLELSI AINNLELSIA PPALCGCGGA AGAIKVL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18287KRRRRK
28293KRRRRKAQERKK
38393RRRRKAQERKK
4149153KKKRR
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000269|PubMed:12172034}.
UniProtTranscription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress weakly the sugar-repressed transcription of promoters containing SRS. Contributes to the sugar-repressed transcription of promoters containing 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q7XC51}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.9G319600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by sucrose. Slightly repressed by gibberellic acid (GA). {ECO:0000269|PubMed:12172034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983632.10.0transcription factor MYBS2
SwissprotB8BI938e-89MYBS2_ORYSI; Transcription factor MYBS2
SwissprotQ7XC518e-89MYBS2_ORYSJ; Transcription factor MYBS2
TrEMBLK4ADK90.0K4ADK9_SETIT; Uncharacterized protein
STRINGSi036966m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104643043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.15e-32MYB_related family protein
Publications ? help Back to Top
  1. Rice Chromosome 10 Sequencing Consortium
    In-depth view of structure, activity, and evolution of rice chromosome 10.
    Science, 2003. 300(5625): p. 1566-9
    [PMID:12791992]