PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G309800.2.p
Common NameSETIT_034202mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 882aa    MW: 94315.6 Da    PI: 5.4779
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G309800.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.61.3e-20138193156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Seita.9G309800.2.p 138 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 193
                         688999***********************************************998 PP

2START131.59.6e-423625992206
                         HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-T CS
               START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv..................dsgealrasgvvdmvlallveellddkeqWde 74 
                         la +aa+ l k+  a+ep+Wv+ +++  +++ +  +  ++                    ++e +r+s+vv+m++ +lv  +ld + +W e
  Seita.9G309800.2.p 362 LAATAADTLAKMCRAGEPLWVRCRSGAGSEVMVADE-HARMfswpvdsgkqgggspvagARTEGSRDSAVVIMNSITLVDAFLDAN-KWME 450
                         5789999*****************555555555555.444459999999999**********************************.**** PP

                         T-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--..-TTSEE-EESSE CS
               START  75 tla....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe.sssvvRaellpS 150
                          ++    ka t++vi+ g        g l lm+ae q++splvp R++vf Ry+     +g+w +vd   +  q     +ssvv+++++pS
  Seita.9G309800.2.p 451 LFPsivsKARTIQVINHGaasghlgsGSLLLMQAEVQFPSPLVPaREVVFFRYCVHnGDEGTWSVVDFPAEGFQLEALqTSSVVKCQRRPS 541
                         ********************************************************777899*****888887777779************ PP

                         EEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 151 giliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                         g++i++++ng+s+v+wveh+++ g     h++++  v +g+a+ga +wv+ lqrqce+
  Seita.9G309800.2.p 542 GCIIQDMPNGYSRVVWVEHMEMVGEEKplHQVFKDYVANGTAFGATRWVSLLQRQCER 599
                         *********************98765449***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-21125189IPR009057Homeodomain-like
SuperFamilySSF466891.17E-19126196IPR009057Homeodomain-like
PROSITE profilePS5007117.07135195IPR001356Homeobox domain
SMARTSM003891.1E-19136199IPR001356Homeobox domain
CDDcd000866.98E-19138196No hitNo description
PfamPF000463.7E-18138193IPR001356Homeobox domain
PROSITE patternPS000270170193IPR017970Homeobox, conserved site
PROSITE profilePS5084844.133352602IPR002913START domain
SuperFamilySSF559611.24E-28355601No hitNo description
SMARTSM002341.2E-20361599IPR002913START domain
PfamPF018524.4E-34362599IPR002913START domain
CDDcd088759.53E-98372598No hitNo description
Gene3DG3DSA:3.30.530.201.7E-4485565IPR023393START-like domain
SuperFamilySSF559612.33E-15616859No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 882 aa     Download sequence    Send to blast
MFGDCQVLSS MAAMAGASSS ADALFIPNPG ALAGFMSSSA AAMPFHHFST TTASLILPKE  60
EGGMMGALQA AKDEDMELEM DMELSGGSGS GHLDGLLSFA DVDDDRPEQK PQHGGLDLQA  120
ADAGQPPQQQ LATANGKKKR YHRHTAHQIQ QMEALFKECP HPDDKQRLKL SQELGLKPRQ  180
VKFWFQNRRT QMKAQQDRAD NVLLRAENES LKSDNYRLQA AIRNVVCPNC GHAAVLGEMS  240
YEEQQLRIEN ARLKDELDRL ACIATRYGGG GRQPSMSSAL VCLPGPPPVL MPPLDLDMSV  300
YSRHFTDQSP VMGCGDLIQS VLAPPPQQIA GGGAENHAAS SSYMGSIMAP VPEQDRQLVL  360
DLAATAADTL AKMCRAGEPL WVRCRSGAGS EVMVADEHAR MFSWPVDSGK QGGGSPVAGA  420
RTEGSRDSAV VIMNSITLVD AFLDANKWME LFPSIVSKAR TIQVINHGAA SGHLGSGSLL  480
LMQAEVQFPS PLVPAREVVF FRYCVHNGDE GTWSVVDFPA EGFQLEALQT SSVVKCQRRP  540
SGCIIQDMPN GYSRVVWVEH MEMVGEEKPL HQVFKDYVAN GTAFGATRWV SLLQRQCERL  600
ASELARNIAD LGVIRTPEAR TNMMKLSQRM ITTFCANISA SGSQSWTALS ESTEDTIRVT  660
TRKNTDPGQP SGVILTAVST SWLSFSHQQV FELLADEQQR CQLEILSNGG SLHEVAHIAN  720
GSHPRNCISL LRINAASNSS QNVELLLQES STHPDGGSLV VFATVDVDAI QVTMSGEDPS  780
YIPLLPLGFA IFPATNPSPA ATSTSSGNGE SSPGNTDEPA SGCLLTVGMQ VLASAVPSAK  840
LNLSSITAIN SHVCNAIHQI TTALKGTGAS RAELAAVGGS D*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509860.0AJ250986.2 Zea mays mRNA for OCL4 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983555.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_004983556.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLK4A5P80.0K4A5P8_SETIT; Uncharacterized protein
STRINGSi034202m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7