PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G258100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 367aa    MW: 38925.1 Da    PI: 6.7059
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G258100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18136188456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++++ eq+++Le+ Fe  +++  e++++LA+ lgL+ rqV +WFqNrRa++k
  Seita.9G258100.1.p 136 KRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWK 188
                         44799***********************************************9 PP

2HD-ZIP_I/II128.42.9e-41134226193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         e+krrls eqv++LE+sFe  +kLeperK++lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aL+r++da ++en++L +++++L++e+
  Seita.9G258100.1.p 134 ERKRRLSVEQVRTLERSFEVANKLEPERKAQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALRRQLDAARAENDALLAHNKKLHAEI 224
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Seita.9G258100.1.p 225 MA 226
                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-20109191IPR009057Homeodomain-like
PROSITE profilePS5007116.973130190IPR001356Homeobox domain
SuperFamilySSF466893.89E-19132192IPR009057Homeodomain-like
SMARTSM003892.5E-18133194IPR001356Homeobox domain
CDDcd000861.39E-17135191No hitNo description
PfamPF000469.0E-16136188IPR001356Homeobox domain
PRINTSPR000315.5E-6161170IPR000047Helix-turn-helix motif
PROSITE patternPS000270165188IPR017970Homeobox, conserved site
PRINTSPR000315.5E-6170186IPR000047Helix-turn-helix motif
PfamPF021839.9E-13190229IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MKPMATNGMA PSFFPANFLL QMQQPLPHHP QQPEHHHHHH HHHHEGHEHE AHHLLAPPPP  60
ALVSPFLHDF GGAMAAPPPM LGGGLGKRMF PDGGVGDDNN NLHAADPQQD GGGGGAASDD  120
EEGSAAAGGG CGGERKRRLS VEQVRTLERS FEVANKLEPE RKAQLARALG LQPRQVAIWF  180
QNRRARWKTK QLEKDYDALR RQLDAARAEN DALLAHNKKL HAEIMALKGG GGNGGGGGGR  240
QEAASELINL NVKETEASCS NRSENSSEIN LDISRPPAPA AAADESPINT THRGLPFYAS  300
AAVDQLLHSS GHPSPAAAPK MELGHSATAD TPAGAAGGSF GSLLCGAVVD EQPPFWPWTD  360
GHHSFQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1133138ERKRRL
2182190RRARWKTKQ
3227239KGGGGNGGGGGGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983144.10.0PREDICTED: homeobox-leucine zipper protein HOX23-like
SwissprotA2Z7341e-101HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
SwissprotQ94GL51e-101HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
TrEMBLC5WM881e-156C5WM88_SORBI; Putative uncharacterized protein Sb01g022420
STRINGSb01g022420.11e-156(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-49HD-ZIP family protein