PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.9G248400.1.p
Common NameSETIT_040014mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 300aa    MW: 32729.6 Da    PI: 4.9012
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.9G248400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.26.8e-1973126356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++ ++q+++Le+ Fe +++++ e+++++A+ l+L  rqV vWFqNrRa++k
  Seita.9G248400.1.p  73 KKRRLAADQVRALERSFEVDNKLDPERKARIARDLSLHPRQVAVWFQNRRARWK 126
                         4557899**********************************************9 PP

2HD-ZIP_I/II125.52.3e-4072164193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+++qv++LE+sFe ++kL+perK+++ar+L l+prqvavWFqnrRAR+ktkq+E+d+++L++++dal++e ++L++++++L++e+
  Seita.9G248400.1.p  72 EKKRRLAADQVRALERSFEVDNKLDPERKARIARDLSLHPRQVAVWFQNRRARWKTKQIERDFTTLRARHDALRAECDALRRDKDALAAEI 162
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         +e
  Seita.9G248400.1.p 163 RE 164
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.2E-1954129IPR009057Homeodomain-like
PROSITE profilePS5007116.47168128IPR001356Homeobox domain
SuperFamilySSF466893.47E-1868130IPR009057Homeodomain-like
SMARTSM003896.0E-1971132IPR001356Homeobox domain
CDDcd000861.47E-1673129No hitNo description
PfamPF000463.6E-1673126IPR001356Homeobox domain
PROSITE patternPS000270103126IPR017970Homeobox, conserved site
PfamPF021831.6E-14128169IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MKRPTSRGSS MVCQATTDQQ EDSCRYMEQR HGVDGGDCGA AAAERDDVEA GAYDEEEEED  60
DELAGSRGGL GEKKRRLAAD QVRALERSFE VDNKLDPERK ARIARDLSLH PRQVAVWFQN  120
RRARWKTKQI ERDFTTLRAR HDALRAECDA LRRDKDALAA EIRELRSKVE KQMEVKLESA  180
EELLPVAAGT AAAAGAVYKD GSTDSDSSAV FNEEASPYSG AAFDHQHHHH QAHPSFTGFT  240
SFLASSTSLS SSFPSLYHGG SHLDQEADGF LSATAADGFF AAEEQGAAGL GSWYGGEGW*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1120128RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0420270.0BT042027.1 Zea mays full-length cDNA clone ZM_BFb0113G23 mRNA, complete cds.
GenBankKJ7275560.0KJ727556.1 Zea mays clone pUT5416 HB transcription factor (HB127) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983072.10.0PREDICTED: homeobox-leucine zipper protein HOX8-like isoform X1
RefseqXP_012704164.10.0PREDICTED: homeobox-leucine zipper protein HOX8-like isoform X1
SwissprotQ338Z75e-99HOX8_ORYSJ; Homeobox-leucine zipper protein HOX8
TrEMBLK4AM780.0K4AM78_SETIT; Uncharacterized protein
STRINGSi040014m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-34homeobox protein 16