PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.8G250200.1.p
Common NameSETIT_026111mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 598aa    MW: 67340.1 Da    PI: 6.4224
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.8G250200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS306.75.4e-942595932335
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cAeav+s+d + a  lL+r+++++sp+gd ++Rla++f+ +L+arla+++s++y+ +  + ts  +++ +l+a+++    + +l 
  Seita.8G250200.1.p 259 HTLLIRCAEAVASNDYRGAADLLERIKHHSSPTGDGTHRLAHCFAMGLEARLAGTGSQIYRLFMDKLTS--STVGVLKAYQFHMTSCCFLL 347
                         679**********************************************************99888887..588999************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         ++hl  N++I++av g +++Hi+ ++++ GlQWp Ll+ La R++gpp++R+Tg+++p++    ++ +eetg+rL++ A+++gvpf+f+  
  Seita.8G250200.1.p 348 VQHLFSNKTIYNAVTGRKKLHIVHYGLGRGLQWPDLLRWLARRDGGPPEVRLTGIDNPQPRfrPAQHIEETGHRLSECARRIGVPFRFRG- 437
                         ***********************************************************9999***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         +ak+le++++e+L+++p+E+l++n++l+l++l+desv +e   +rd vL+++++++P v++++ ++ +h+s+ F++rf e l+ y+alfd+
  Seita.8G250200.1.p 438 IAKKLEAVQVEDLDIDPDEVLVINSILHLQSLMDESVFVERsnPRDMVLSTIRKMRPSVFIHAVNNGSHSSAFFMTRFREVLHSYTALFDM 528
                         7***********************************98776669*********************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaak 335
                         ++a +pr++++r  vEr +++  i+n++aceg +r++r +++++W+ r ++aG++++pl+ ++++
  Seita.8G250200.1.p 529 MDAIAPRDDDKRLLVERDMFAACITNIIACEGMDRVQRPQSYKQWQIRSQRAGLRQLPLDPEIVQ 593
                         ***********************************************************988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098556.537232598IPR005202Transcription factor GRAS
PfamPF035141.9E-91259593IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 598 aa     Download sequence    Send to blast
MTITPELEDK QQQQGVMAET TQQPSPSVFL DDLPLLAPCI IDIDGGKDDS SPEDDGNLVL  60
PYISRMLMED ITGEFSDRYN PDHPALLKAQ QPFAEILSNA IQKCPCKQLS QPAPLRMDTV  120
EAKSLQLMTD KGSSCVDVVS MAFFKGMEEA NKFLPIPTDS DETVWPSCRR KKKRLDRDDE  180
TTAQAQEVGM STSKQMAASL QPAETEEEAA AREMLDRLML NGYDHPSLAA DMLEPPYVDI  240
GMIGKTTPPR GRRHAVDLHT LLIRCAEAVA SNDYRGAADL LERIKHHSSP TGDGTHRLAH  300
CFAMGLEARL AGTGSQIYRL FMDKLTSSTV GVLKAYQFHM TSCCFLLVQH LFSNKTIYNA  360
VTGRKKLHIV HYGLGRGLQW PDLLRWLARR DGGPPEVRLT GIDNPQPRFR PAQHIEETGH  420
RLSECARRIG VPFRFRGIAK KLEAVQVEDL DIDPDEVLVI NSILHLQSLM DESVFVERSN  480
PRDMVLSTIR KMRPSVFIHA VNNGSHSSAF FMTRFREVLH SYTALFDMMD AIAPRDDDKR  540
LLVERDMFAA CITNIIACEG MDRVQRPQSY KQWQIRSQRA GLRQLPLDPE IVQMLKDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-382625878328GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168173RRKKKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980083.10.0PREDICTED: scarecrow-like protein 9
TrEMBLK3ZHQ90.0K3ZHQ9_SETIT; Uncharacterized protein
STRINGSi026111m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-116GRAS family protein