PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.8G063700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 623aa    MW: 69348.6 Da    PI: 8.9967
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.8G063700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2067122156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +r + +ft++q+e+Le+lF+ + +p+  +r+eLA+k+gL+ rqVk+WFqN+R+k k
  Seita.8G063700.1.p  67 KRGKNRFTAKQIEQLESLFQLSAHPDDPTRQELADKIGLEARQVKFWFQNQRTKTK 122
                         678899************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-2144124IPR009057Homeodomain-like
SuperFamilySSF466894.18E-1855123IPR009057Homeodomain-like
PROSITE profilePS5007118.28564124IPR001356Homeobox domain
SMARTSM003894.3E-1866128IPR001356Homeobox domain
CDDcd000863.42E-1567122No hitNo description
PfamPF000465.5E-1867122IPR001356Homeobox domain
PROSITE patternPS00027099122IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MDNEWQLNSN NEQGMGLNPG NETAYPNWIN HMEEYDIDAL LDAEDHVNTD QDEDDEEHHH  60
DGSKSSKRGK NRFTAKQIEQ LESLFQLSAH PDDPTRQELA DKIGLEARQV KFWFQNQRTK  120
TKAKAVGDQN KDIKQENAQL HAENMKLQQT LACGRCRDPT EHKWHLLNEN ARLKDTKRRA  180
QEYLIKLIHD SNLPHSETLE HLESASLNLV PFDDNGSTYQ ATLLSYAERA LNEFMMLAVK  240
DEPMWLPTIN GKMLHNQEYN CRTCPGLLGP CPQGFVMEAT KQTTTVRGTA SDLVAMLTDV  300
SCWSKMFPGI IESVRASKVV SSGISTSRDG LIQEMNVDLW VQSPRAPNRS VKFLSTHLSR  360
GSLSPGEGGA AEAACGQGEG ACGRSEADCG RLEGAREPAA GSCGRREVEP RRCCVRRRRR  420
QPAAGGREPA VGGRRTVAGW RDRGSLRPAA AAGGRWSRGG VAACRRAVAI AVTIATADVE  480
WWCAGVKCAR LDTRSGPQSS HATTTMWRRR RQPMGHRSRR ERRRAAWRRQ TTGLEMTASA  540
GFKATDGGSF WGDARVGGTG EAAEARMHGG RRRDGSEGWR GIGWKEMLGA RATDRRRTTY  600
GEKVWIGRRK LPLAQDEVER KE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1172178LKDTKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980253.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
TrEMBLK3YEP10.0K3YEP1_SETIT; Uncharacterized protein
STRINGSi012707m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.11e-40protodermal factor 2