PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G268300.1.p
Common NameSETIT_012046mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 608aa    MW: 68357.1 Da    PI: 6.3573
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G268300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2761.2e-8423760111373
                GRAS  11 avssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                         av+++d   a++lL++++++as++gd +qRla++f+++L+arl++++s++ +  + + +++ + +e l a++l+  ++ + k+  l    +
  Seita.7G268300.1.p 237 AVAANDDMTASELLKQIKQHASETGDVTQRLAQCFAKGLEARLVGMGSQVWQLWQLRMADRLSIVELLEARNLYAAACSFNKVVLLFSTMT 327
                         8999*******************************************************9999**************************** PP

                GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                         Il+a+ g+ r+Hi+D+++ +G++W+ Ll+ LasR++gpp+++iT++g+p+     +e++ee+g rL+k A+e+gvpf+f + + k++e+++
  Seita.7G268300.1.p 328 ILQAMVGKGRLHIVDYGMRYGFHWADLLRLLASREGGPPKVKITAIGPPNLRpcPTEQIEEIGYRLSKCAHEFGVPFNFYA-IRKKWEEVS 417
                         ************************************************999999***************************.7******** PP

                GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                         +e+L+++ gE+l+Vn  l+  +l+des   ++  ++d vL+ +++++P +++ +  ++++ ++s+l rf e + y+sa+fd ++a++pr+s
  Seita.7G268300.1.p 418 IEDLNTDAGEVLIVNDRLNFNSLMDESIFFDDpsPKDIVLHNIRKMRPAIFIQSIVNSSY-GSSYLSRFREVVFYFSAIFDLFDATIPRDS 507
                         ***************************977766699***********************9.6789************************** PP

                GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                         + r+++E+ l+g  + n++aceg++  +r e++++W++r ++aG++++pl+ ++++  k  + +++ + + + e+ ++l++gW++r L++ 
  Seita.7G268300.1.p 508 KLRVVLEQDLFGGLALNAIACEGTDLMNRPEKYKQWHARNQRAGLRQLPLKPSIVNALKDEVMRCYHRDFLICEDGQWLLQGWMGRILFAQ 598
                         ******************************************************************999********************** PP

                GRAS 371 SaW 373
                         S W
  Seita.7G268300.1.p 599 STW 601
                         *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.783201582IPR005202Transcription factor GRAS
PfamPF035144.1E-82237601IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 608 aa     Download sequence    Send to blast
MATTPDELFV EGLTEKSPQS PSVFLDVFSP KPDDRSEGCH HVPSDMMLPY ISRMLMEDDI  60
DDKPSDHPAL LQVQQPFAQI LSSPSFGSNH GDTEGANDLL QDSSGDERTL HLALSKGTYA  120
VGAFLKGMKE ANMLLPIANN GFRRDKLVNQ MVSESSNHSG AKKRYARDDH IEEGEARRTS  180
KSLMRVTEPK DTCAHEMLDD MMLRGTETSI IRCMEKLRIA MANGAEKTTR KGSRNAAVAA  240
NDDMTASELL KQIKQHASET GDVTQRLAQC FAKGLEARLV GMGSQVWQLW QLRMADRLSI  300
VELLEARNLY AAACSFNKVV LLFSTMTILQ AMVGKGRLHI VDYGMRYGFH WADLLRLLAS  360
REGGPPKVKI TAIGPPNLRP CPTEQIEEIG YRLSKCAHEF GVPFNFYAIR KKWEEVSIED  420
LNTDAGEVLI VNDRLNFNSL MDESIFFDDP SPKDIVLHNI RKMRPAIFIQ SIVNSSYGSS  480
YLSRFREVVF YFSAIFDLFD ATIPRDSKLR VVLEQDLFGG LALNAIACEG TDLMNRPEKY  540
KQWHARNQRA GLRQLPLKPS IVNALKDEVM RCYHRDFLIC EDGQWLLQGW MGRILFAQST  600
WVADDTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-2923860114374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978278.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3YCU60.0K3YCU6_SETIT; Uncharacterized protein
STRINGSi012046m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-102SCARECROW-like 14