PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G268200.1.p
Common NameSETIT_012328mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 607aa    MW: 68412.2 Da    PI: 6.548
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G268200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS278.71.7e-8523760011373
                GRAS  11 avssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
                         av+++d   a++lL++++ +as++gd +qRla++f+++L+arl++++s++ +  ++ + +  +++e l+a++l+  ++ + ++  l    +
  Seita.7G268200.1.p 237 AVAANDDMTARELLKQIKRHASETGDVTQRLAQCFAKGLEARLVGMGSQVWQLRTADRLR-PTTVEFLKAHNLLTAACSFNRVVLLFSTMT 326
                         8999**********************************************9766665555.678999************************ PP

                GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledle 190
                         Il+a+ g+ r+Hi+D+++ +G++W+ Ll+ LasR++gpp++++T++g+p+    s e++ee+g rL+k A+e+gvpf+f + + k++e+++
  Seita.7G268200.1.p 327 ILQAMVGKGRLHIVDYGMHHGFHWADLLRLLASREGGPPKVKVTAIGHPDLRpcSIEQIEEIGYRLSKCAHEFGVPFNFYA-IRKKWEEVS 416
                         ************************************************999899***************************.7******** PP

                GRAS 191 leeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres 279
                         +e+L+++ gE+l+Vn +l+  +l+des   ++  +++ vL+ +++++P v++ +  ++++ ++s+l rf e + y+sa+fd+++a++pr+s
  Seita.7G268200.1.p 417 IEDLNTDAGEVLIVNDHLNFNTLMDESIFFDDpsPKNIVLHNIRKMRPAVFIQSIVNSSY-GASYLSRFREVVFYFSAIFDMFDATIPRDS 506
                         ***************************97777558899********************99.789*************************** PP

                GRAS 280 eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsv 370
                         + r+++E+ l+g  + n++aceg++r++r e++++W++r ++aG++++pl+ ++++  k  + +++ + + + e+ ++l+ gW++r L++ 
  Seita.7G268200.1.p 507 KCRVVLEQDLFGCFALNAIACEGTDRINRPEKYKQWHARNQRAGLRQLPLEPSIVNALKDEVMRCYHRDFLICEDGQWLLHGWMGRILFAQ 597
                         ******************************************************************999********************** PP

                GRAS 371 SaW 373
                         S W
  Seita.7G268200.1.p 598 STW 600
                         *** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.549201581IPR005202Transcription factor GRAS
PfamPF035145.9E-83237600IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 607 aa     Download sequence    Send to blast
MATTPDELFV EGLTEMSPQS PSVFLDVFSP KPDDRSEGCH HVPSDMMLPY ISRMLMEDDI  60
DDKPADHPAL LQVQQPFAQI LSSPSFGSNH GDTEGANDLL QDSSGDERTL HLALSKGTFA  120
VGAFLKGMKE ANMLLPIANN GFRRDELVNQ MVSESSNHSG AKKRYARDDH IEEGEARRTS  180
KSLMRIKEPK DICAHEMLDD MMLRGTEPCI IRCMEKLRIA MANGTEKTTR KGSRNAAVAA  240
NDDMTARELL KQIKRHASET GDVTQRLAQC FAKGLEARLV GMGSQVWQLR TADRLRPTTV  300
EFLKAHNLLT AACSFNRVVL LFSTMTILQA MVGKGRLHIV DYGMHHGFHW ADLLRLLASR  360
EGGPPKVKVT AIGHPDLRPC SIEQIEEIGY RLSKCAHEFG VPFNFYAIRK KWEEVSIEDL  420
NTDAGEVLIV NDHLNFNTLM DESIFFDDPS PKNIVLHNIR KMRPAVFIQS IVNSSYGASY  480
LSRFREVVFY FSAIFDMFDA TIPRDSKCRV VLEQDLFGCF ALNAIACEGT DRINRPEKYK  540
QWHARNQRAG LRQLPLEPSI VNALKDEVMR CYHRDFLICE DGQWLLHGWM GRILFAQSTW  600
VADDTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3023860014374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978277.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3YDM30.0K3YDM3_SETIT; Uncharacterized protein
STRINGSi012328m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-100GRAS family protein