PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G187800.1.p
Common NameLOC101760222, SETIT_010958mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 238aa    MW: 26043.7 Da    PI: 8.935
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G187800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.4e-1975129256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++k+q  +Le+ F+++++++ ++++ LA++lgL  rqV vWFqNrRa+ k
  Seita.7G187800.1.p  75 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTK 129
                         788899***********************************************98 PP

2HD-ZIP_I/II129.31.6e-4175164191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlsk+q+++LE+sF+e+ +L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Seita.7G187800.1.p  75 RKKLRLSKDQSAVLEDSFREHPTLNPRQKAALAQQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCETLTEENRRLQKEVQELR-AL 164
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.68E-1967132IPR009057Homeodomain-like
PROSITE profilePS5007117.31371131IPR001356Homeobox domain
SMARTSM003897.4E-1873135IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.5E-1975129IPR009057Homeodomain-like
PfamPF000466.7E-1775129IPR001356Homeobox domain
CDDcd000862.78E-1675132No hitNo description
PRINTSPR000314.1E-6102111IPR000047Helix-turn-helix motif
PROSITE patternPS000270106129IPR017970Homeobox, conserved site
PRINTSPR000314.1E-6111127IPR000047Helix-turn-helix motif
SMARTSM003404.4E-25131174IPR003106Leucine zipper, homeobox-associated
PfamPF021832.2E-11131165IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MMERAEDLGL SLSLSSSLAA PRTHHVSAML LRSPEKRFLE MPLLPAKRSE VTAEEGLLRG  60
GSDEEDGSCG IDGSRKKLRL SKDQSAVLED SFREHPTLNP RQKAALAQQL GLRPRQVEVW  120
FQNRRARTKL KQTEVDCEFL KRCCETLTEE NRRLQKEVQE LRALKLVSPH LYMHMSPPTT  180
LTMCPSCERV SSSGANSTGA AASSDRRAGG AIISTAAAAA EGAAICHRPI AVRPQQS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17379SRKKLRL
2123131RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9749800.0EU974980.1 Zea mays clone 462177 homeobox-leucine zipper protein ATHB-4 mRNA, complete cds.
GenBankKJ7283620.0KJ728362.1 Zea mays clone pUT6644 HB transcription factor (HB53) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976428.11e-173PREDICTED: homeobox-leucine zipper protein HOX17-like
SwissprotQ01I231e-116HOX17_ORYSI; Homeobox-leucine zipper protein HOX17
TrEMBLK3Y9R61e-173K3Y9R6_SETIT; Uncharacterized protein
STRINGSi010958m1e-172(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25873889
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.13e-73homeobox-leucine zipper protein 3