PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G112100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 622aa    MW: 69993.2 Da    PI: 6.514
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G112100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS273.85.3e-842426132373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cA+av+ ++     +lL++++++as +gd+mqRla++f ++L+arl++++++l + l + + s     e l+a++l+  ++ + k
  Seita.7G112100.1.p 242 STLLIRCAQAVDRSNYLIGGELLNQIKQHASTTGDAMQRLAQCFSKGLQARLMGTGKQLRNLLIADRPS---AMEFLKAYNLYMSACYFNK 329
                         579********************************************************9999777777...89***************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgv..gspesgskeeleetgerLakfAeelgvpfefnv 180
                         ++h+    +I + ++g++r+Hi+ ++i   +QW+ L++ La+R++gpp  ++iT++  ++pes+  + +ee g rL+k+A+elg+pf f+v
  Seita.7G112100.1.p 330 VAHIFSALTIAQVMKGKSRLHIVGYGIHGAFQWAGLIRWLAKREGGPPlGMKITTIccSHPESFPVQWIEEQGYRLSKYASELGLPFVFEV 420
                         ********************************************999989****9733677777**************************9 PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          v+ + e++ +++L+v+ +E+l+V+  ++l +l des   +s  +rd+vL+ +k+++P+v++ +  +++ n++ Fl rf ++l yysalfd
  Seita.7G112100.1.p 421 -VTAEREKVCIQNLNVDADEVLVVSDLFNLSTLKDESIFFDSpnPRDTVLSNIKKMRPNVFIQSVLNCS-NGSCFLSRFRQKLFYYSALFD 509
                         .688889999***************************97776669**************9987777765.7999***************** PP

                GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
                         +l+a +prese r+++E+ellgr + n++aceg +  +  e++++W++r ++aG++++pl+  +++  k  ++k++ +   + ee ++l++
  Seita.7G112100.1.p 510 MLDAIVPRESEPRSVLEQELLGRYVLNAIACEGIDLAQHPEKYRQWQSRNQRAGLRQLPLRPVVVNVLKDKVKKHHHKDLLLSEEGQWLLQ 600
                         ****************************************************************************888************ PP

                GRAS 361 gWkdrpLvsvSaW 373
                         gWk+r L++ S W
  Seita.7G112100.1.p 601 GWKGRVLFAHSTW 613
                         ************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098549.318215594IPR005202Transcription factor GRAS
PfamPF035141.8E-81242613IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 622 aa     Download sequence    Send to blast
MATTPEEFFA EGLMEPSPPS PSVFLDLNPM PDSNTADKGQ LSHDDLLLPN ISCMHMEDDI  60
DGKLLCQYSD HPALLQAQQP FDRILSSPPI SAKNDDAANK GNMDQADDLL LVSSGDKSTL  120
SLAFSDGEYV VGEFLKGMED ANRFLPSDNS FIKGHQMNQM FIRSKRKHLE EEVGRTSKIM  180
MTTTEVPEET GIHEMLDDMM TGGDEALIRD MEKLRTAMSN KEEKKKRRKG SSKVTRDMVD  240
LSTLLIRCAQ AVDRSNYLIG GELLNQIKQH ASTTGDAMQR LAQCFSKGLQ ARLMGTGKQL  300
RNLLIADRPS AMEFLKAYNL YMSACYFNKV AHIFSALTIA QVMKGKSRLH IVGYGIHGAF  360
QWAGLIRWLA KREGGPPLGM KITTICCSHP ESFPVQWIEE QGYRLSKYAS ELGLPFVFEV  420
VTAEREKVCI QNLNVDADEV LVVSDLFNLS TLKDESIFFD SPNPRDTVLS NIKKMRPNVF  480
IQSVLNCSNG SCFLSRFRQK LFYYSALFDM LDAIVPRESE PRSVLEQELL GRYVLNAIAC  540
EGIDLAQHPE KYRQWQSRNQ RAGLRQLPLR PVVVNVLKDK VKKHHHKDLL LSEEGQWLLQ  600
GWKGRVLFAH STWVVEDGSS E*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-252456138374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1223227KKKRR
2223228KKKRRK
3224228KKRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978028.20.0PREDICTED: scarecrow-like protein 9
TrEMBLK3YDL30.0K3YDL3_SETIT; Uncharacterized protein
STRINGSi012318m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.19e-95SCARECROW-like 14