PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G112000.1.p
Common NameLOC101783857, SETIT_009582mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 604aa    MW: 66124 Da    PI: 5.1565
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G112000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2913.3e-892195972374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPil 91 
                          + L++cAeav++gd + a  lL+r++ ++sp+gd  qRla+yf+ +L+arla+ ++s+ly++l ++++s    s+ l a +l+   + ++
  Seita.7G112000.1.p 219 HTMLMRCAEAVAAGDRNGAADLLERIRRHSSPAGDGAQRLAHYFAAGLEARLAGgTGSRLYRSLMVRRSS---LSDYLRACQLYMAGCCFV 306
                         578***************************************************99*********99999...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                          + +l   ++I +av+g +++Hi+ ++++ GlQWp  l+ L +R++gpp++R+Tg++sp +g   +e +eetg+rL++ A+++gvpf+f++
  Seita.7G112000.1.p 307 PVIFLFSSETICRAVAGRKKLHIVSYGLGRGLQWPDVLRRLGNRDGGPPEVRLTGIDSPLPGfqPAELVEETGRRLSDCARRFGVPFRFRA 397
                         ***********************************************************999999999*********************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaV.nlvlqlhrll......desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                          +a r ed+  + L+++p+E+l+V  + ++  +l+        ++  +++ d+vL+++++++P v++++  +a+++++ Fl+rf e l++ 
  Seita.7G112000.1.p 398 -IAARSEDVVADGLDIDPDEVLVVvESTFHFRSLMdeggvvTVDGRNTNPMDTVLNTIREMRPSVFIHAVINASYSTAFFLTRFREVLYHS 487
                         .7999***************9865167777777774444444455556699**************************************** PP

                GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveees 355
                         +alfd++++ lpr+++ r  +Er +l++ +vnv+aceg++r ++ +++++W++r ++aG++++pl+  +++  k  +++ + + +++ e++
  Seita.7G112000.1.p 488 TALFDMMDTVLPRDDDRRLLLERDVLAQCAVNVIACEGEDRMHQPRSYKQWQARSRRAGLRQLPLDRGIVQMLKDKVKEEYHKCFEISEDQ 578
                         *********************************************************************************999******* PP

                GRAS 356 gslvlgWkdrpLvsvSaWr 374
                         ++l++gWk+r L+++S W+
  Seita.7G112000.1.p 579 QWLLQGWKGRVLYALSTWT 597
                         ******************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.576192577IPR005202Transcription factor GRAS
PfamPF035141.1E-86219597IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MEDSIVDKFL CQYPDHPALV QAQQLFSHIL SDASSSVLAE QPCNFAELFS VQSSAPAPAA  60
AAVLSVAQGS NIEDTAFFLN GMATDAVESI NSSLPAESTG CCMDVVSMAF FKGMEEASKF  120
LPSDAMTVGG GGRGQKKRLD GDDDEAELGS TMGRSSKQMA TAADGEESEE AAAREMLDQL  180
MLNGCVPSAA DMQELRAATT EMEKAPRGRR GTGAAVDLHT MLMRCAEAVA AGDRNGAADL  240
LERIRRHSSP AGDGAQRLAH YFAAGLEARL AGGTGSRLYR SLMVRRSSLS DYLRACQLYM  300
AGCCFVPVIF LFSSETICRA VAGRKKLHIV SYGLGRGLQW PDVLRRLGNR DGGPPEVRLT  360
GIDSPLPGFQ PAELVEETGR RLSDCARRFG VPFRFRAIAA RSEDVVADGL DIDPDEVLVV  420
VESTFHFRSL MDEGGVVTVD GRNTNPMDTV LNTIREMRPS VFIHAVINAS YSTAFFLTRF  480
REVLYHSTAL FDMMDTVLPR DDDRRLLLER DVLAQCAVNV IACEGEDRMH QPRSYKQWQA  540
RSRRAGLRQL PLDRGIVQML KDKVKEEYHK CFEISEDQQW LLQGWKGRVL YALSTWTAGD  600
DLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-342225968374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978027.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3Y5U30.0K3Y5U3_SETIT; Uncharacterized protein
STRINGSi009582m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-119GRAS family protein