PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G110000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family M-type_MADS
Protein Properties Length: 110aa    MW: 12489.7 Da    PI: 10.5637
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G110000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.12.3e-231058250
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        rien   rqvtf+kRr g+lKKA+EL vL da++ vi+fs++gk+ye +
  Seita.7G110000.1.p 10 RIENPVHRQVTFCKRRMGLLKKANELAVLSDADIGVIVFSPHGKMYELA 58
                        8*********************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006627.375161IPR002100Transcription factor, MADS-box
SMARTSM004326.2E-33160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.11E-26174IPR002100Transcription factor, MADS-box
CDDcd002654.22E-35272No hitNo description
PRINTSPR004045.6E-24323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.3E-231056IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004045.6E-243859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MARGKIHMRR IENPVHRQVT FCKRRMGLLK KANELAVLSD ADIGVIVFSP HGKMYELATN  60
GNMQGLIERY KTAYGEMKGE SSRKMKPQAI PQEVLALTHE IELLRKDLR*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.7G110000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025823445.12e-62MADS-box transcription factor 26-like isoform X2
SwissprotA2YQK91e-41MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G81e-41MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLA0A368RUF15e-75A0A368RUF1_SETIT; Uncharacterized protein
STRINGSi012632m6e-57(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.11e-40AGAMOUS-like 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Lee S, et al.
    Further characterization of a rice AGL12 group MADS-box gene, OsMADS26.
    Plant Physiol., 2008. 147(1): p. 156-68
    [PMID:18354041]
  3. Khong GN, et al.
    OsMADS26 Negatively Regulates Resistance to Pathogens and Drought Tolerance in Rice.
    Plant Physiol., 2015. 169(4): p. 2935-49
    [PMID:26424158]