PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.7G060900.1.p
Common NameSETIT_012320mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 752aa    MW: 82916.7 Da    PI: 6.4577
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.7G060900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.7e-1967118556
                         SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +f+  q++eLe++F+ + +p+ae+r++L +++gL+erqV++WFqNrR  +k
  Seita.7G060900.1.p  67 KRFNVRQVQELEAMFHACTHPDAEQRQQLGTRIGLEERQVRFWFQNRRSLMK 118
                         4799********************************************8776 PP

2START107.32.5e-342324563205
                         HHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
               START   3 aeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                         ae+a +elv +a+ ++p+W+        +++ + lq+f+          +  ea r++ +  +++++lv++l d++ qW+e+++     + 
  Seita.7G060900.1.p 232 AERAFKELVMLATKGQPLWMPTIdgeVLNDQHYDLQTFPGL-LgfcpwgFVAEATRETDMIKGEAMDLVSILTDVA-QWSEMFPdivsYVR 320
                         688999*****************876566777779999443.26999999**************************.*******9888888 PP

                         EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-...EESSEEEEEEEECTC CS
               START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRa...ellpSgiliepksng 160
                           +vi+sg      g +qlm  e+ + +p  p R++ f+R+++ + + +w++vdvSvd +q+  + +ss++ +   +llpSg+++e +  g
  Seita.7G060900.1.p 321 SSNVICSGssslrdGLIQLMDVEFWVQTPCLPtRNVKFLRFSKMMAERKWAVVDVSVDGNQHGYQqQSSGASCtgyRLLPSGCILEGMRSG 411
                         8899**********************************************************9999666666644479************* PP

                         EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
               START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          +kvtwv h ++ ++ ++ l+r +++sg+a+ga +w++ +qrqce
  Seita.7G060900.1.p 412 FCKVTWVVHGEYLEAAVPTLFRKFLHSGQAFGACRWLRSFQRQCE 456
                         ********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-1750118IPR009057Homeodomain-like
SuperFamilySSF466891.0E-1651118IPR009057Homeodomain-like
PROSITE profilePS5007116.01860120IPR001356Homeobox domain
SMARTSM003893.4E-1763124IPR001356Homeobox domain
CDDcd000861.35E-1564120No hitNo description
PfamPF000468.8E-1767118IPR001356Homeobox domain
PROSITE profilePS5084827.348221460IPR002913START domain
SMARTSM002344.3E-12230457IPR002913START domain
SuperFamilySSF559613.43E-15230456No hitNo description
CDDcd088754.15E-74232456No hitNo description
PfamPF018527.0E-27232456IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 752 aa     Download sequence    Send to blast
MENDGHLNNN KEQALGLTLG DATAWDYPVE YDMDALLGED HNVDTNQRTH DEDHLPESET  60
PQSKRPKRFN VRQVQELEAM FHACTHPDAE QRQQLGTRIG LEERQVRFWF QNRRSLMKLK  120
ACGNEVKELQ QENGKLQADN NELKQLMLDP TCFKCRDPAG ATQTTLERQR LLRENARLKD  180
ELQRANAYLK RSIREAGRRP QPMSSENQAS AYMNPVPFTC NRTNQATLRS HAERAFKELV  240
MLATKGQPLW MPTIDGEVLN DQHYDLQTFP GLLGFCPWGF VAEATRETDM IKGEAMDLVS  300
ILTDVAQWSE MFPDIVSYVR SSNVICSGSS SLRDGLIQLM DVEFWVQTPC LPTRNVKFLR  360
FSKMMAERKW AVVDVSVDGN QHGYQQQSSG ASCTGYRLLP SGCILEGMRS GFCKVTWVVH  420
GEYLEAAVPT LFRKFLHSGQ AFGACRWLRS FQRQCEYMAV LASSHVPSSS SSSSGAAISS  480
LGKRGVLELA QRMTASFYAA ISGPVTIAST NITNQWCVSS GTAAERVDAA VRMVIWNCAE  540
IMPGEPAITV LSATTTVRLP GTPPVRVFEY LCNLQRRGEW DSFVNGGQVK ELGYVSTSAR  600
LHGNAVSVLR PTIVAQGSRG MNNNMLILQQ SSTDASGSLV VYSLIEENVM RGIMAGAENN  660
IFLVPSGFAI LPDGHGKARY NAASSSTSAP IDNNDDDGEG ALLTVAFQAM LPSSPSGDHA  720
TTRAFDNAGQ QLCDAIKKIK DAVGANNVIV N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008669630.10.0PREDICTED: homeobox-leucine zipper protein ROC6-like
TrEMBLK3YDL50.0K3YDL5_SETIT; Uncharacterized protein
STRINGSi012320m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83241742
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.11e-124HD-ZIP family protein