PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G231100.1.p
Common NameLOC101754126, SETIT_015587mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family bZIP
Protein Properties Length: 380aa    MW: 40118 Da    PI: 6.4467
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G231100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1279.6e-09196254563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         k+++r + NR +A rs +RK  +i+eLe+kv+ ++ e +aL+ +l  l+   a l++e+
  Seita.6G231100.1.p 196 KKAKRIINNRQSAARSKERKMRYIAELERKVQFMQREATALATQLALLQRDTAGLTAEN 254
                         89**********************************************99999988887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-14192256IPR004827Basic-leucine zipper domain
PfamPF077161.6E-7194245IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.634194257IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-9196251No hitNo description
SuperFamilySSF579595.91E-10196250No hitNo description
CDDcd147031.76E-22197248No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 380 aa     Download sequence    Send to blast
MNMDTKPIAG GGGGGGGDAE GGGSCAAGNV PAMQSSCDAV APSPAPHTEC DMSRMPDSPV  60
RKPGHRRALS DIIGLPNDLD LGAPGAGDGP VLSDENEEEL FSMFLDVEKL NSRCGASESE  120
SSCAMAGGGG EATQMSAAPG AGLRPRHHQR HSMDASSSID AENLFGTSAM DGVSPVEAKK  180
AMSAAKLAEL ALIDPKKAKR IINNRQSAAR SKERKMRYIA ELERKVQFMQ REATALATQL  240
ALLQRDTAGL TAENSELKLR LQNTEHQVHL QDALNDALKS ELQRLKMATG QMGSGGGAMN  300
FGASPHPFGA NHHHQQMFHP NQAMPPPFAA MQQQQQQLLP NQPLHPLQTQ QAAINLNMKG  360
PAPAPNQWWG DAWSESSSS*
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269|PubMed:11390974, ECO:0000269|PubMed:12855676, ECO:0000269|PubMed:14704272, ECO:0000269|PubMed:9311985}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.6G231100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974066.10.0transcription factor RF2a
SwissprotQ69IL41e-106RF2A_ORYSJ; Transcription factor RF2a
TrEMBLK3YMV40.0K3YMV4_SETIT; Uncharacterized protein
STRINGSi015587m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42693868
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06070.18e-72bZIP family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Dai S,Zhang Z,Bick J,Beachy RN
    Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus.
    J. Gen. Virol., 2006. 87(Pt 3): p. 715-22
    [PMID:16476995]
  3. Liu Y,Dai S,Beachy RN
    Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription.
    Biochem. J., 2007. 405(2): p. 243-9
    [PMID:17371296]
  4. Dai S, et al.
    Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease.
    Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6
    [PMID:19104064]
  5. Ordiz MI,Yang J,Barbazuk WB,Beachy RN
    Functional analysis of the activation domain of RF2a, a rice transcription factor.
    Plant Biotechnol. J., 2010. 8(7): p. 835-44
    [PMID:20408988]