PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G205200.1.p
Common NameLOC101778576, SETIT_013426mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family EIL
Protein Properties Length: 620aa    MW: 68203.3 Da    PI: 6.1405
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G205200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3416.43.2e-127383741333
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         eel +rmwkd+++lkr+ker+++l  ++  +++++k++k+++qa rkkm+raQDgiLkYM+k mevcna+GfvYgiip+kgkpv+gasd++
  Seita.6G205200.1.p  38 EELARRMWKDKIKLKRIKERQQKLALQRL-ELEKSKTKKISDQALRKKMARAQDGILKYMIKLMEVCNARGFVYGIIPDKGKPVSGASDNI 127
                         8*********************9775555.5************************************************************ PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWkekv+fd+ngpaai+ky+ +n ils+++s+   + + +hsl++lqD tlgSLLsalm hc+p+qrr+pl+kgv+pPWWP+G+e+ww+
  Seita.6G205200.1.p 128 RAWWKEKVKFDKNGPAAITKYEVENSILSNAKSN---GAKDQHSLMDLQDGTLGSLLSALMLHCSPQQRRYPLDKGVPPPWWPSGNEAWWS 215
                         *****************************99999...88**************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXX CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspk 273
                         +lgl+k    ppykkphdlkk+wkv+vLt vikhm+p++++ir+++r+sk+lqdkm+ake  ++l vl++eek ++++    s++   +++
  Seita.6G205200.1.p 216 SLGLPKGEA-PPYKKPHDLKKVWKVGVLTGVIKHMAPNFDKIRNHVRKSKCLQDKMTAKENLIWLGVLQREEKSVNSFGNALSEI--TRNE 303
                         ******998.9**************************************************************998888775443..6788 PP

                         XXXXXXXXXXXXXXXXXX.XXXXXXXXXX...........XXXXXXXXXXXXXXXXXXXXX......XXXX CS
                EIN3 274 vtlsceqkedvegkkeskikhvqavktta...........gfpvvrkrkkkpsesakvsskevsrtcqssq 333
                          ++s+++++dv+  +++  ++++++++ +           ++  +++r++ +s+++ vs++++++  q+++
  Seita.6G205200.1.p 304 DIYSSSDEYDVDRLEQPPHSTSSKEDEDTqpvlqirgkktSTRENKRRRRDKSSNQVVSKEDMTKSRQQQS 374
                         8999999*****44444444444444333467777655544444444444455555555555444444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.8E-12438286No hitNo description
Gene3DG3DSA:1.10.3180.103.6E-67160291IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167685.49E-59166288IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 620 aa     Download sequence    Send to blast
MDHLAILASE VDDASDFDVD GINSLSENDV SDEEIDAEEL ARRMWKDKIK LKRIKERQQK  60
LALQRLELEK SKTKKISDQA LRKKMARAQD GILKYMIKLM EVCNARGFVY GIIPDKGKPV  120
SGASDNIRAW WKEKVKFDKN GPAAITKYEV ENSILSNAKS NGAKDQHSLM DLQDGTLGSL  180
LSALMLHCSP QQRRYPLDKG VPPPWWPSGN EAWWSSLGLP KGEAPPYKKP HDLKKVWKVG  240
VLTGVIKHMA PNFDKIRNHV RKSKCLQDKM TAKENLIWLG VLQREEKSVN SFGNALSEIT  300
RNEDIYSSSD EYDVDRLEQP PHSTSSKEDE DTQPVLQIRG KKTSTRENKR RRRDKSSNQV  360
VSKEDMTKSR QQQSLSGHPP VAEDEVEVTQ RNDNPPEIGS SAIGDVNIFD PLDVVGITNQ  420
PACDPIPTYG SLQQHGDYQG NFLSPGAALN NYNSNQAASA ALNKHNNNQA ASAAQSSTYL  480
SDPPLACEGS DIANSWSGHS FRQDVGHGPI GFNPSAIVQA SSMQQQQPLP MDHHVPIMGT  540
GALSGNGSYS YPAAGSGHSG TVASKAEQLM DDPFFGEATD KFAGNSFGGL PLSLIPISSP  600
IPYLDELLDD DDLMQYLGT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A7e-601662939136ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1349354RRRRDK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973869.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-134EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLK3YGQ80.0K3YGQ8_SETIT; Uncharacterized protein
STRINGSi013426m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37203779
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-134ETHYLENE-INSENSITIVE3-like 3