PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G187700.1.p
Common NameLOC101756675, SETIT_014231mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 280aa    MW: 29580.8 Da    PI: 4.5862
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G187700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-1954107356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k+++++++q+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Seita.6G187700.1.p  54 KKRRLSTDQVRALERSFETENKLEPERKARLAQDLGLQPRQVAVWFQNRRARWK 107
                         45689************************************************9 PP

2HD-ZIP_I/II134.63.4e-4353145193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls++qv++LE+sFe+e+kLeperK++la++LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal++++++L++++++L +e+
  Seita.6G187700.1.p  53 EKKRRLSTDQVRALERSFETENKLEPERKARLAQDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDALRADHDALRRDKDTLIAEI 143
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ke
  Seita.6G187700.1.p 144 KE 145
                         87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.33E-1943111IPR009057Homeodomain-like
SMARTSM003891.3E-1852113IPR001356Homeobox domain
PROSITE profilePS5007117.18453109IPR001356Homeobox domain
CDDcd000867.26E-1854110No hitNo description
PfamPF000461.1E-1654107IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.9E-2056116IPR009057Homeodomain-like
PRINTSPR000318.6E-68089IPR000047Helix-turn-helix motif
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
PRINTSPR000318.6E-689105IPR000047Helix-turn-helix motif
PfamPF021836.6E-18109150IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MKRPSGAVSG GGGSPGLLPI VQSDDGFGGV GVEEADEDMV LCSGGVGACG GGEKKRRLST  60
DQVRALERSF ETENKLEPER KARLAQDLGL QPRQVAVWFQ NRRARWKTKQ LERDYAALRH  120
SYDALRADHD ALRRDKDTLI AEIKELKAKL GDEDAAASFS SVKEEPAASD VEPPAAAAAM  180
AAQGSSDSDS SGVVNDAEMA PEKAHPPAAA AGAEAVVPCG VASSLALHHG EVFFHGHLLK  240
VEDDEAAFLG DDDAACGGFF ADLQPPSLPW WTEPTEHWA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17884ERKARLA
2101109RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973728.10.0PREDICTED: homeobox-leucine zipper protein HOX20
SwissprotA2YWC01e-118HOX20_ORYSI; Homeobox-leucine zipper protein HOX20
SwissprotQ6Z2481e-118HOX20_ORYSJ; Homeobox-leucine zipper protein HOX20
TrEMBLK3YJ120.0K3YJ12_SETIT; Uncharacterized protein
STRINGSi014231m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.15e-47homeobox protein 16