PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G160500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family ZF-HD
Protein Properties Length: 122aa    MW: 12496.2 Da    PI: 8.2912
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G160500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.71.6e-293185358
         ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                        +vrY eC++NhAas+GghavDGC+Ef+++ geegt+aal+CaACgCHR+FHRr v+
  Seita.6G160500.1.p 31 GVRYGECRRNHAASMGGHAVDGCREFLAE-GEEGTTAALRCAACGCHRSFHRRVVQ 85
                        68**************************8.999********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-183285IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.6E-293284IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.0E-253382IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.6453483IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MKRMVILRRC HPPPPPEALL AGGCCGGGGG GVRYGECRRN HAASMGGHAV DGCREFLAEG  60
EEGTTAALRC AACGCHRSFH RRVVQRCCCC LCCGAGAAAR WGGGDDGRCS PESSASSTTP  120
R*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.6G160500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0656182e-73BT065618.1 Zea mays full-length cDNA clone ZM_BFb0349A13 mRNA, complete cds.
GenBankEU9719692e-73EU971969.1 Zea mays clone 372958 mini zinc finger 3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973532.11e-79mini zinc finger protein 4-like
SwissprotQ0J5F84e-35MIF4_ORYSJ; Mini zinc finger protein 4
TrEMBLA0A368RMB83e-78A0A368RMB8_SETIT; Uncharacterized protein
STRINGGRMZM2G370863_P012e-38(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.17e-26mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]