PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.6G072700.1.p
Common NameLOC101778839, SETIT_013279mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 794aa    MW: 85139 Da    PI: 5.826
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.6G072700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.21.6e-19108163156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t++q++eLe++F++ ++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Seita.6G072700.1.p 108 KKRYHRHTQHQIQELEAFFKEFPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 163
                         688999***********************************************999 PP

2START204.25.3e-643005241206
                         HHHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
               START   1 elaeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                         ela +a++elv++a+++ep+Wv         e +n++e+   f+++ +      ++ea+r+++vv+m++++lve l+d++ qW++ +    
  Seita.6G072700.1.p 300 ELAVAAMEELVRMAQLGEPLWVPALvdgaatETLNEEEYAHGFPRGVGpkspeLHSEASRETVVVIMNHVNLVEMLMDVN-QWSTLFSsiv 389
                         57899*****************9999*****************99777********************************.******9999 PP

                         .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTC CS
               START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksng 160
                          +a+tlev+s+g      galqlm+ae+q++splvp R++ fvRy++q+++g+w++vdvS+d  +     + + R++++pSg+li++++ng
  Seita.6G072700.1.p 390 sRAATLEVLSTGvagnynGALQLMTAEFQVPSPLVPtRESQFVRYCKQHTDGSWAVVDVSLDGLRAG--GAVGLRGRRRPSGCLIREMPNG 478
                         9*****************************************************************8..589******************* PP

                         EEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 161 hskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         +s+vtwvehv+ +++++h l+r+lv+sgla+ga++w a+l+rqce+
  Seita.6G072700.1.p 479 YSRVTWVEHVEADDAMVHDLYRPLVSSGLAFGAQRWAAALERQCER 524
                         ********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-2190149IPR009057Homeodomain-like
SuperFamilySSF466892.38E-1995166IPR009057Homeodomain-like
PROSITE profilePS5007117.2105165IPR001356Homeobox domain
SMARTSM003894.4E-19106169IPR001356Homeobox domain
CDDcd000864.93E-19107166No hitNo description
PfamPF000464.3E-17108163IPR001356Homeobox domain
PROSITE patternPS000270140163IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.609.8E-5150193IPR009057Homeodomain-like
PROSITE profilePS5084842.736291527IPR002913START domain
SuperFamilySSF559611.53E-32294526No hitNo description
CDDcd088751.86E-120295523No hitNo description
SMARTSM002347.0E-62300524IPR002913START domain
PfamPF018526.2E-53301524IPR002913START domain
Gene3DG3DSA:3.30.530.205.4E-5370519IPR023393START-like domain
SuperFamilySSF559611.72E-24550772No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MPGGMMIPGR NMPTAAAMIG GLASYAASLG QNMMDGQHQL AVMQQQQHQN HGQQQQPVTS  60
ESDMHGSRHD ELLMESKSGS DNMEGGAGSG SGGEELQEED LSLQQPRKKR YHRHTQHQIQ  120
ELEAFFKEFP HPDDKQRKEL SRELGLEPLQ VKFWFQNKRT QMKTQQERQE NTQLRAENEK  180
LRAENARYKD ALANAACPNC GGPATAVIGE MSFDEHHLRI ENARLHDEID RISAIAAKYV  240
GKPVASLLPN SSNISSVVAT AAPYPQPLST HHIIPGAADM FGGLHHRGAA AGFDKPLVIE  300
LAVAAMEELV RMAQLGEPLW VPALVDGAAT ETLNEEEYAH GFPRGVGPKS PELHSEASRE  360
TVVVIMNHVN LVEMLMDVNQ WSTLFSSIVS RAATLEVLST GVAGNYNGAL QLMTAEFQVP  420
SPLVPTRESQ FVRYCKQHTD GSWAVVDVSL DGLRAGGAVG LRGRRRPSGC LIREMPNGYS  480
RVTWVEHVEA DDAMVHDLYR PLVSSGLAFG AQRWAAALER QCERLASAMA SGVPAASTGG  540
DAAGVVNSAE GRRSMLRLAE RMVASFCGGV TASTTHQWTT LSGSGPEDVR VMTRKSVDDP  600
GRPPGIILNA ATSFWLPVPP ARVFGFLRDD ATRSEWDILS NGGDVQEMAH IANGRDHGNA  660
VSLLRVNNAN SNQSNMLILQ ECCTDKTGSY VIYAPVDVVA MNVVLNGGDP DYVALLPSGF  720
AILPDGPGAG GGGSLLTVAF QILVDSVPTA KLSLGSVATV NSLIACTVER IKAALAADNT  780
AGGGARPPPY GDE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004972909.10.0PREDICTED: homeobox-leucine zipper protein ROC7-like
SwissprotA3BPF20.0ROC7_ORYSJ; Homeobox-leucine zipper protein ROC7
TrEMBLK3YGB10.0K3YGB1_SETIT; Uncharacterized protein
STRINGSi013279m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein