PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G452200.1.p
Common NameSETIT_002428mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 295aa    MW: 32309.7 Da    PI: 4.4005
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G452200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding271.1e-085187340
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
     Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                        +WT +E +ll++a + + g+ W+ Ia+++  ++t +q+
  Seita.5G452200.1.p 51 NWTDQETLLLLEALEIFKGKEWDEIAEHVV-TKTKEQI 87
                        8*****************************.***9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129311.88647100IPR017884SANT domain
SuperFamilySSF466892.77E-74788IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-55087IPR009057Homeodomain-like
PfamPF002491.5E-75187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MTRRRRANRG EEVSRDSSCR DSHVGKFDEG MSNADFILME YTEVPGSGGS NWTDQETLLL  60
LEALEIFKGK EWDEIAEHVV TKTKEQICQT GTFDVPEEMD VDDNAEGKES TDGKTFKKAD  120
ANSSETGTKL ADQSVSAKED TMNPGEKTFK KADANPSCCN SLRAISEISP ALQLATGHCF  180
ILPDPPSNLE DPTSNFSPCT GGVCQGGAGG TQNVNATDKD RSEREESALA LEKERATFTS  240
QKEHMELSNT KESFVEGPQA EVIILSYYVL QRSIIINIYY IYASMSNLCV HNMG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.5G452200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0537863e-64BT053786.1 Zea mays full-length cDNA clone ZM_BFb0168L21 mRNA, complete cds.
GenBankBT0663303e-64BT066330.1 Zea mays full-length cDNA clone ZM_BFb0179F16 mRNA, complete cds.
GenBankEU9522273e-64EU952227.1 Zea mays clone 1231171 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022682046.11e-154uncharacterized protein LOC111257196
TrEMBLK3XKK50.0K3XKK5_SETIT; Uncharacterized protein
STRINGSi002428m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45421214