PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G327600.2.p
Common NameLOC101777880, SETIT_002496mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family TCP
Protein Properties Length: 282aa    MW: 29931.4 Da    PI: 8.8552
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G327600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP93.93.3e-2945112370
                 TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                         g+kdrhsk+ T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl++a ++i++l+ ++++++
  Seita.5G327600.2.p  45 GGKDRHSKVKTVKGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNAARHEIDKLPPLQFPPQ 112
                         78*************************************************************99988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036346.7E-2746107IPR005333Transcription factor, TCP
PROSITE profilePS5136929.95146104IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MISGAGNQQA AADEELARKN AAVATSRQWS AQTESRIVRV SRVFGGKDRH SKVKTVKGLR  60
DRRVRLSVPT AIQLYDLQDR LGLNQPSKVV DWLLNAARHE IDKLPPLQFP PQDHHLMVGH  120
LAPPMPLVHE EKFVGHHIAT AAALASDGGA KVGQGGDVDM DWGGAASHHM GRFPAGGYHR  180
FMGLNSAFGM VSSAMAPYSN YTAGEARNNS NVHDGGGGGS PQVAAAAAAH HSSFPSLLSL  240
APGPHQLVFY SPEADQQFQV DNLGSQSLSL SSARAYHDQA S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A2e-2051105155Putative transcription factor PCF6
5zkt_B2e-2051105155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.5G327600.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970055.10.0transcription factor PCF5
TrEMBLK3XKS30.0K3XKS3_SETIT; Uncharacterized protein
STRINGSi002496m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.12e-41TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5