PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G183700.1.p
Common NameLOC101774492, SETIT_002433mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 293aa    MW: 30350.1 Da    PI: 7.9436
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G183700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-12138182347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
  Seita.5G183700.1.p 138 PWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKY 182
                         7*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.7866IPR001005SANT/Myb domain
PROSITE profilePS500905.5411264IPR017877Myb-like domain
SuperFamilySSF466893.92E-51270IPR009057Homeodomain-like
PROSITE profilePS5129416.873131187IPR017930Myb domain
SuperFamilySSF466896.96E-17133188IPR009057Homeodomain-like
SMARTSM007172.3E-10135185IPR001005SANT/Myb domain
TIGRFAMsTIGR015574.0E-17135185IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.606.2E-11136181IPR009057Homeodomain-like
PfamPF002497.1E-11138182IPR001005SANT/Myb domain
CDDcd001679.36E-10138183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MTTVATTTAA AWTREEDKAF ENAVAAAAAP PADGPPDEGW FAALAASVPA RTAEEVRRHY  60
EALVEDVAAI EAGRVPLPSY AGEDPSAATP DSAAGAASAP KDGGGGGGGG HRREERKSGV  120
DVGKSCSKAE QERRKGIPWT EEEHRLFLLG LDKFGKGDWR SISRNFVISR TPTQVASHAQ  180
KYFIRLNSMN RDRRRSSIHD ITSVTAGEVA AAGAPITGGP AAAGAMPMGP AGMKHHHPGP  240
PMGMYGHAPM GHPVAGHMVA PAAVGTPVMF PPGHSPYVVP VGYPAPPAKM HQ*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:22773748}.
UniProtTranscription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q8LH59}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.5G183700.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269|PubMed:12172034}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0553330.0BT055333.2 Zea mays full-length cDNA clone ZM_BFb0024K03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004968851.10.0transcription factor MYBS1
SwissprotB8A9B21e-124MYBS1_ORYSI; Transcription factor MYBS1
SwissprotQ8LH591e-124MYBS1_ORYSJ; Transcription factor MYBS1
TrEMBLK3XKL00.0K3XKL0_SETIT; Uncharacterized protein
STRINGSi002433m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94663041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G49010.13e-52MYB family protein
Publications ? help Back to Top
  1. Hong YF, et al.
    Convergent starvation signals and hormone crosstalk in regulating nutrient mobilization upon germination in cereals.
    Plant Cell, 2012. 24(7): p. 2857-73
    [PMID:22773748]