PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G124900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family BES1
Protein Properties Length: 171aa    MW: 18479.4 Da    PI: 9.2733
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G124900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822133.13.1e-41441572116
              DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspes 92 
                         +s r+pt +ErEnn++RERrRR++aa+iyaGLRa+++y lpk+aD+n+Vl+ALc+eAG+ v+d+G++ r +  p   a+   +s++ ++ s
  Seita.5G124900.1.p  44 TSLRHPTPRERENNRQRERRRRQVAARIYAGLRAHAGYTLPKHADQNDVLRALCAEAGYHVDDGGNVTRLQGVPD-GAAGPSCSSDHQKPS 133
                         789******************************************************************666676.566666666666666 PP

              DUF822  93 slqsslkssalaspvesysaspks 116
                         s + ++++ +l+ p ++++  +++
  Seita.5G124900.1.p 134 SHSGATEAATLQQPEQQQQLEEET 157
                         666677888888888887766554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.1E-3046150IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MEVGAGREEG EAAAAPVAGR RGCIRSTQGP WTVRRRGRGG GLTTSLRHPT PRERENNRQR  60
ERRRRQVAAR IYAGLRAHAG YTLPKHADQN DVLRALCAEA GYHVDDGGNV TRLQGVPDGA  120
AGPSCSSDHQ KPSSHSGATE AATLQQPEQQ QQLEEETKLS LELTLSFAYM *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A4e-1118112343437Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B4e-1118112343437Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C4e-1118112343437Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D4e-1118112343437Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.5G124900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9477561e-114EU947756.1 Zea mays clone 356679 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004971713.11e-121protein BZR1 homolog 3-like
TrEMBLA0A368R3Z71e-120A0A368R3Z7_SETIT; Uncharacterized protein
STRINGPavir.J23744.1.p3e-73(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132013032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19350.35e-14BES1 family protein