PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.5G044000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 251aa    MW: 26724.4 Da    PI: 7.1129
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.5G044000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.92.4e-1883127147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r ++++eE+e+l+ a++ +G++ W++Iar ++ gRt++ +k++w+ +
  Seita.5G044000.1.p  83 RRAFSEEEEERLLAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHVL 127
                         678*******************.*********.***********987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.9E-1774135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-1977131IPR009057Homeodomain-like
PROSITE profilePS5129427.73378132IPR017930Myb domain
SMARTSM007178.8E-1682130IPR001005SANT/Myb domain
PfamPF002492.5E-1583127IPR001005SANT/Myb domain
CDDcd001673.80E-894128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MAHEMAAFFG AAPPPPAALA PFRDEQRHRD AADEVYHVDD VEDGDAGHGH GGGGGQGKLC  60
ARGHWRPAED AKLKELLDPR INRRAFSEEE EERLLAAHRA YGNKWALIAR LFPGRTDNAV  120
KNHWHVLMAR KQREQSGALR RRKTSSSSSS SPGPAPPQHY APVVVLHHHH YSGSPPLPFH  180
AAATATAAGA HGVPTEAAAA DTRAYSGGES DESASTCTTD LSLGSAPCFY QSAYNPGYDA  240
APRAAAFAPS A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-147713153107B-MYB
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.5G044000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022682305.11e-118transcription factor CSA-like
SwissprotQ5NBM87e-57CSA_ORYSJ; Transcription factor CSA
TrEMBLA0A368R1530.0A0A368R153_SETIT; Uncharacterized protein (Fragment)
STRINGPavir.J31094.1.p1e-102(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.13e-29myb domain protein 105
Publications ? help Back to Top
  1. Leonard LM,Follette VM
    Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications.
    Annu Rev Sex Res, 2002. 13: p. 346-88
    [PMID:12836736]
  2. Wang L,Li X,Chen Z
    Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities.
    Int. J. Biol. Macromol., 2009. 44(2): p. 211-4
    [PMID:19135473]
  3. Wang L,Huang H,Wei Y,Li X,Chen Z
    Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran.
    Int. J. Biol. Macromol., 2009. 45(4): p. 427-31
    [PMID:19549538]
  4. Zhang H, et al.
    Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development.
    Plant Cell, 2010. 22(3): p. 672-89
    [PMID:20305120]
  5. Zhang H, et al.
    Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production.
    Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81
    [PMID:23256151]
  6. Zhu X, et al.
    Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein.
    Plant J., 2015. 82(4): p. 570-81
    [PMID:25754973]
  7. Li X, et al.
    Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress.
    Plant Cell Environ., 2015. 38(10): p. 2171-92
    [PMID:25828772]
  8. Shaar-Moshe L,Hübner S,Peleg Z
    Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach.
    BMC Plant Biol., 2015. 15: p. 111
    [PMID:25935420]