PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G085600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 274aa    MW: 30734.4 Da    PI: 6.3468
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G085600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.51.8e-09125159337
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtl 37 
                          WT+ E+ l++++ + +G g+Wk I++++ k+Rt+
  Seita.4G085600.1.p 125 FWTKPEHRLFLRGLHVYGHGNWKNISKYFVKTRTP 159
                         6********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-8120161IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-8124161IPR009057Homeodomain-like
PfamPF002498.3E-7126159IPR001005SANT/Myb domain
CDDcd001672.51E-8126161No hitNo description
PROSITE profilePS500906.33126161IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MVKSLIARYN SDSSYTNDMN KKHNDIVNEV HATLPLKEKH QIIHLYVDLM MEMMQSGISD  60
GSYHSAMTSR DLSNNNFEIP VEDPTIDNMD MLLGYPTMEI MATRVAQEVP RRQPTSRMEK  120
KHIGFWTKPE HRLFLRGLHV YGHGNWKNIS KYFVKTRTPM QRYSINDVGL YDVEPWAQNN  180
TSGKEGSTFT SSANNPNRYG ANGQHATMNN LTQVYEATND NGQAAAGAGD QQMRATSSST  240
PPIMEGAGGP QVAWAGDQLG DFFPDQMMNM DML*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.4G085600.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966689.11e-124uncharacterized protein LOC101759880
TrEMBLA0A368QSI40.0A0A368QSI4_SETIT; Uncharacterized protein
STRINGSi008720m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.23e-12MYB_related family protein