PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G020600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family BBR-BPC
Protein Properties Length: 330aa    MW: 36550.4 Da    PI: 9.9441
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G020600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind3881.4e-11823291301
           GAGA_bind   1 mdddgsre..rnkg.yye......paaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkll 82 
                         md+ g+re  r+++ +y+        ++lk++ +++l+++++e+d++irer++al+ekkaa+aerdmaf+qrd+a+aern+a+verdn+l+
  Seita.4G020600.1.p   2 MDNLGHREngRQRPdQYKavhtqwMMPQLKDHHSMNLLALMNEKDSAIRERDHALAEKKAAIAERDMAFAQRDAAMAERNAAIVERDNALA 92 
                         9999*99999****99998886543389*************************************************************** PP

           GAGA_bind  83 alllvensla.salpvgvqv...lsgtksidslqqlse.....pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekk 163
                         al+l++++   +++++g +    l+gtk+i++++qls+      ql+ds+++ +re++++ea+pi +a++++ + kk++k++++++p+++ 
  Seita.4G020600.1.p  93 ALELARTNGFnMNNGNGFHQvppLNGTKNIHNHDQLSHvqtspLQLADSPYDhTREMHISEAYPIATAPSSIGKGKKPRKNSSQASPLKRP 183
                         **998887654555555544112689*********998899999********9*************************************9 PP

           GAGA_bind 164 ak..kkkkksekskkkvkkesader......skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPv 246
                         +   +k+kk + ++k+  +++  e+      +k+e+k++dl+ln+v +Dest+P+P+CsCtG lrqCYkWGnGGWqS+CCt+++S+yPLPv
  Seita.4G020600.1.p 184 SGvlRKTKKVAGDWKNGGMSGGGEDsarasvMKNEWKDQDLGLNQVPFDESTMPAPACSCTGELRQCYKWGNGGWQSSCCTMSMSMYPLPV 274
                         99887777788999999998866445788889*********************************************************** PP

           GAGA_bind 247 stkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         +++rr+aR++grKmS++af+klL++LaaeG+dls+pvDLkdhWAkHGtn+++tir
  Seita.4G020600.1.p 275 MPNRRHARMGGRKMSGSAFTKLLSRLAAEGHDLSTPVDLKDHWAKHGTNRYITIR 329
                         ******************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062176.0E-962329IPR010409GAGA-binding transcriptional activator
SMARTSM012261.3E-1652329IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MMDNLGHREN GRQRPDQYKA VHTQWMMPQL KDHHSMNLLA LMNEKDSAIR ERDHALAEKK  60
AAIAERDMAF AQRDAAMAER NAAIVERDNA LAALELARTN GFNMNNGNGF HQVPPLNGTK  120
NIHNHDQLSH VQTSPLQLAD SPYDHTREMH ISEAYPIATA PSSIGKGKKP RKNSSQASPL  180
KRPSGVLRKT KKVAGDWKNG GMSGGGEDSA RASVMKNEWK DQDLGLNQVP FDESTMPAPA  240
CSCTGELRQC YKWGNGGWQS SCCTMSMSMY PLPVMPNRRH ARMGGRKMSG SAFTKLLSRL  300
AAEGHDLSTP VDLKDHWAKH GTNRYITIR*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00540DAPTransfer from AT5G42520Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.4G020600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1847590.0KF184759.1 Saccharum hybrid cultivar R570 clone BAC 015H09 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964426.10.0barley B recombinant-like protein D
RefseqXP_004964427.10.0barley B recombinant-like protein D
SwissprotQ5VSA80.0BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBLA0A368QQ320.0A0A368QQ32_SETIT; Uncharacterized protein
STRINGSi006972m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62263756
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.11e-102basic pentacysteine 6
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]