PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G004600.2.p
Common NameLOC101769735, SETIT_006883mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 323aa    MW: 35263.6 Da    PI: 7.2202
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G004600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding40.37.4e-1369113147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r +WT+ E++++++a +++  + Wk+I +++g  +t  q++s+ qky
  Seita.4G004600.2.p  69 RESWTEPEHDKFLEALQLFDRD-WKKIEAYVG-SKTVIQIRSHAQKY 113
                         789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.14E-1663119IPR009057Homeodomain-like
PROSITE profilePS5129414.62864118IPR017930Myb domain
TIGRFAMsTIGR015571.1E-1867116IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.607.6E-668109IPR009057Homeodomain-like
SMARTSM007172.7E-1068116IPR001005SANT/Myb domain
PfamPF002491.2E-1069113IPR001005SANT/Myb domain
CDDcd001677.77E-871114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MVSMSTTPHP LDSSVPGVGG GGGGGGEGKE AARRVRLVQA AAPTAVPLGD EDDEGPRRVR  60
KPYTITKSRE SWTEPEHDKF LEALQLFDRD WKKIEAYVGS KTVIQIRSHA QKYFLKVQKN  120
GTGEHLPPPR PKRKAAHPYP HKASKKALQV VLPQQASHIM EQGCGTSMDT ATVATDLSAN  180
DAFLSWENDP VQQFSPRHTQ GSGATNNYSS SIGSQSGTWP TSEATEQAVM LPALRAMPDF  240
ARVYSFLGSI FDPETNGHLQ KLKEMDPIDA ETVLLLMKNL SINLTSPNFE EHRRLLASHD  300
SSMDQDVGSS HTVHLPFMIT SK*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.4G004600.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964289.10.0protein REVEILLE 6 isoform X1
SwissprotQ8H0W33e-94RVE6_ARATH; Protein REVEILLE 6
TrEMBLK3XYA00.0K3XYA0_SETIT; Uncharacterized protein
STRINGSi006883m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.24e-81MYB_related family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]