PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G380300.1.p
Common NameLOC101764174, SETIT_024639mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 618aa    MW: 69907.2 Da    PI: 6.9437
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G380300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS287.34.3e-882446112373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         +++L+ cA+av+++d  +a++lL++++++as++gd +qRla++f+++L+arl +++s++       + +  +  e l a +l+  +  + +
  Seita.3G380300.1.p 244 RTTLILCAQAVAANDDMRASKLLKQIKQHASETGDVTQRLAQCFAKGLEARLEGMGSQVR------QLRMADRLELLEACNLLTAAWSFNR 328
                         6789**************************************************665554......444445789999************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +  l    +Il+a+ g+ r+Hi+D+++ +G++W+ Ll+ LasR++gpp+++iT++g+p+    ske++eetg rL+k A+e+gvpf+f + 
  Seita.3G380300.1.p 329 VVLLFSTMTILQAMVGKGRLHIVDYGMRYGFHWADLLRLLASREGGPPKVKITTIGHPNLRrrSKEQIEETGYRLSKCAHEFGVPFNFYA- 418
                         *********************************************************999899***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                         + k++e++++++L+++ gE+l+Vn  ++  +l+des   ++  ++d vL+ +++++P v++ +  ++++ ++s+l rf e + y++a+fd 
  Seita.3G380300.1.p 419 IRKKWEEVSIKDLNTDAGEVLIVNDLMNFNTLMDESIFFDDpcPKDIVLHNIRKMRPAVFIQSIVNSSY-GPSYLSRFREVVFYFTAIFDI 508
                         7************************************99998899*********************999.899****************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l+a++pr+s+ r+++E+ l+gr++ n++aceg++  er e++++W++r ++aG++++pl+ ++++  k  + +++ + + + e+ ++l++g
  Seita.3G380300.1.p 509 LDATIPRDSKLRVVLEQDLFGRSVLNAIACEGTDLMERPEKYKQWHARNQRAGLRQLPLKPSIVNVLKDKVMRCYHRDFLICEDGQWLLQG 599
                         ***************************************************************************999************* PP

                GRAS 362 WkdrpLvsvSaW 373
                         W++r L++ S W
  Seita.3G380300.1.p 600 WMGRILFAQSTW 611
                         ************ PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.243217592IPR005202Transcription factor GRAS
PfamPF035141.5E-85244611IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
MATTPEELFV EGLTEKSPQS PSVFLDVFSP KPDDRSEGCH HVPSDMVLSY ISRMLMEDDI  60
DDKPSDHPAL LQVQQPFAQI LSSPSFGSNH GDTEGANDLL QDSSGGERTL HLALSKSTYA  120
VGAFLKGMKE ANMLLPIANN GFRRDELVNQ MVRESSNHSG AKKRYASDDH IEEEEARRTS  180
KSLMMIKEPK DICAHEMLDD MMLRGTETFI IRCMEKLRIA MANEAEKSTR KGSRNAVANV  240
VDIRTTLILC AQAVAANDDM RASKLLKQIK QHASETGDVT QRLAQCFAKG LEARLEGMGS  300
QVRQLRMADR LELLEACNLL TAAWSFNRVV LLFSTMTILQ AMVGKGRLHI VDYGMRYGFH  360
WADLLRLLAS REGGPPKVKI TTIGHPNLRR RSKEQIEETG YRLSKCAHEF GVPFNFYAIR  420
KKWEEVSIKD LNTDAGEVLI VNDLMNFNTL MDESIFFDDP CPKDIVLHNI RKMRPAVFIQ  480
SIVNSSYGPS YLSRFREVVF YFTAIFDILD ATIPRDSKLR VVLEQDLFGR SVLNAIACEG  540
TDLMERPEKY KQWHARNQRA GLRQLPLKPS IVNVLKDKVM RCYHRDFLIC EDGQWLLQGW  600
MGRILFAQST WVADDTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-302436114374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964176.10.0PREDICTED: scarecrow-like protein 33
TrEMBLK3ZDK10.0K3ZDK1_SETIT; Uncharacterized protein
STRINGSi024639m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.11e-110GRAS family protein