PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G325400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 498aa    MW: 55636.4 Da    PI: 8.0523
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G325400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS86.83.5e-271532631114
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+av+s+d ++a++lL++++++asp+gd++qRla++f+e+L+arla+++s +y++l +++ts    ++ l+a++l+  +  + 
  Seita.3G325400.1.p 153 LRTLLIHCAQAVASDDRRNATELLKQIKQHASPQGDATQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVDILQAYQLYMAAICFK 240
                         6789************************************************************999998...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHi 114
                         k+ ++  Nq+I++a  g++++Hi
  Seita.3G325400.1.p 241 KVVFIFSNQTIYNASLGKKKIHI 263
                         **********************9 PP

2GRAS203.11.6e-62269487155373
                GRAS 155 keeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqe 245
                         ++++eetg+rL+k+A+e+gvpf+++v++a+++e+++ e+L+++p+E+l+Vn+ +q ++l+desv +es+rd vL+ +++++P+ ++++  +
  Seita.3G325400.1.p 269 TQRIEETGRRLSKYAQEFGVPFKYQVIAASKMETIRAEDLNLDPEEVLIVNCLYQFKNLMDESVLIESPRDIVLNNIRKMRPHAFIHAIVN 359
                         6899*************************************************************************************** PP

                GRAS 246 adhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakq 336
                          + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++aG+k++pl+ ++++ 
  Seita.3G325400.1.p 360 GSFSAPFFVTRFREALFYYSALFDVLDTTTPRDSNQRMLIEQNIFGRAALNVIACEGTDRVERPETYKQWQVRNQRAGLKQLPLNPDVVQV 450
                         ******************************************************************************************* PP

                GRAS 337 aklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         ++  +  ++ + + ++ ++++l++gWk+r L+++S W
  Seita.3G325400.1.p 451 VRDKVDGCYHKDFVIDIDHNWLLQGWKGRILYAISTW 487
                         *********889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098535.46127468IPR005202Transcription factor GRAS
PfamPF035141.2E-24153263IPR005202Transcription factor GRAS
PfamPF035145.6E-60269487IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
DKLVIDLDPP EDAKRFVLPT ENKFAAAGFN GSAPVAAAVA VKEEVVAVAA PDAVPGGGGG  60
VGGRGRKNRF YDDEEDLEMD RRSSKQSALQ GDGDDRDVFD KYMITSHEMC VEQMEKLRIA  120
MQEEAAKKEA VNGNGKAKAK GGGRRGGREV VDLRTLLIHC AQAVASDDRR NATELLKQIK  180
QHASPQGDAT QRLAHCFAEG LQARLAGTGS MVYQSLMAKR TSAVDILQAY QLYMAAICFK  240
KVVFIFSNQT IYNASLGKKK IHIPGFRPTQ RIEETGRRLS KYAQEFGVPF KYQVIAASKM  300
ETIRAEDLNL DPEEVLIVNC LYQFKNLMDE SVLIESPRDI VLNNIRKMRP HAFIHAIVNG  360
SFSAPFFVTR FREALFYYSA LFDVLDTTTP RDSNQRMLIE QNIFGRAALN VIACEGTDRV  420
ERPETYKQWQ VRNQRAGLKQ LPLNPDVVQV VRDKVDGCYH KDFVIDIDHN WLLQGWKGRI  480
LYAISTWVAN DDAGSYF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-251574878374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0366170.0BT036617.1 Zea mays full-length cDNA clone ZM_BFb0126F15 mRNA, complete cds.
GenBankBT0356410.0BT035641.1 Zea mays full-length cDNA clone ZM_BFb0073P23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660358.10.0PREDICTED: LOW QUALITY PROTEIN: scarecrow-like protein 9
SwissprotO809331e-140SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3ZD860.0K3ZD86_SETIT; Uncharacterized protein
STRINGSi024520m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-137GRAS family protein