PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G225500.1.p
Common NameLOC101784952, SETIT_023363mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 188aa    MW: 20730 Da    PI: 9.4119
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G225500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.21e-14119163347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+ l++++ +++G g+W+ I+r   k+Rt+ q+ s+ qky
  Seita.3G225500.1.p 119 PWTEEEHRLFLEGLEKYGRGDWRNISRWSVKTRTPTQVASHAQKY 163
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.0622276IPR017877Myb-like domain
SuperFamilySSF466891.59E-112477IPR009057Homeodomain-like
SMARTSM007170.00812678IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-62776IPR009057Homeodomain-like
PROSITE profilePS5129420.291112168IPR017930Myb domain
SuperFamilySSF466892.35E-18114168IPR009057Homeodomain-like
SMARTSM007179.2E-11116166IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.7E-17116167IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-11118162IPR009057Homeodomain-like
PfamPF002491.3E-11119163IPR001005SANT/Myb domain
CDDcd001676.65E-11119164No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MAFYYGVSGQ SSSPAAAAWG APPTPSSRPW TKAEDKVFEG ALVTFPEHVP NRWVLVASQL  60
PGRTAQEAWD HYQALLTDVD LIERGMVEAP GSWDHDDAAA GRGRGRGAGS GDERRRGVPW  120
TEEEHRLFLE GLEKYGRGDW RNISRWSVKT RTPTQVASHA QKYFIRQASA GSRGDTKRKS  180
IHDITTP*
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.3G225500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3679541e-138AK367954.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2065H11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961933.11e-135transcription factor DIVARICATA
SwissprotQ8S9H73e-51DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3Z9Z21e-133K3Z9Z2_SETIT; Uncharacterized protein
STRINGSi023363m1e-134(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28953687
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.16e-45Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
    [PMID:11937495]
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92
    [PMID:9118809]