PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G163600.1.p
Common NameSETIT_021925mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 478aa    MW: 53815.2 Da    PI: 9.7822
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G163600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding23.51.3e-07169211346
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +W+ eE ++l ++++++  + +  Ia +++++R+ +++ksr+++
  Seita.3G163600.1.p 169 AWSREETDQLFELCERFDLR-FIVIADRFPTTRSVEDLKSRYYS 211
                         7*******************.*********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162827.6E-31142216IPR032563DAMP1, SANT/Myb-like domain
SMARTSM007173.0E-7166215IPR001005SANT/Myb domain
SuperFamilySSF466894.08E-6166220IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.9E-5169214IPR009057Homeodomain-like
CDDcd116581.49E-17170212No hitNo description
PfamPF054997.4E-7348411IPR008468DNA methyltransferase 1-associated 1
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MDAKDILGLP KTPFSSSLEK KSRPPKEPQR KPDGVSREVY ALTGGVGMAP LMPTIEASHL  60
KRRPAAEKEK LNFLMCIASN EYYLRVRKRE STVCHVVLCC ELNILAHVAW QWLPFTSSAR  120
SDNLQLYHWV RVVNGVPPTG DYQFAKYNKK VDVLKYTDEE YEKYLIDPAW SREETDQLFE  180
LCERFDLRFI VIADRFPTTR SVEDLKSRYY SVSRSLLIHR SRSFDDVSGN PLVKDSYDAA  240
HETERKRALS ALLSQTKQQE RKDAETLAEA KRIMESRAAS KNVDEAGMPS SSDNAMVPVD  300
GVSPLSSTHP PLTHPNTAAN SSIPNSLRTL RVYLRTHALD QMVQAASASA GLRVIKRVDQ  360
TLQDLGVNLK PKVPTKAVCV EHLELRNEIL TLLNLQKQLQ NKEAEVSANR ESSFTEAPST  420
PKRSNRDIDR TFIPDTVGFS GERAGKRDHK RKTTGRFIDA PPSPTQSKRP RKLKGSD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A6e-20141216483DNA methyltransferase 1-associated protein 1
4iej_A6e-20141216483DNA methyltransferase 1-associated protein 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the SWR1 complex which mediates the ATP-dependent exchange of histone H2A for the H2A variant HZT1 leading to transcriptional regulation of selected genes by chromatin remodeling. Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of selected genes principally by acetylation of nucleosomal histone H4 and H2A. {ECO:0000305|Ref.5}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.3G163600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9684390.0EU968439.1 Zea mays clone 320860 DNA methyltransferase 1-associated protein 1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700354.10.0SWR1-complex protein 4
SwissprotQ8VZL61e-179SWC4_ARATH; SWR1-complex protein 4
TrEMBLK3Z5V70.0K3Z5V7_SETIT; Uncharacterized protein
STRINGSi021927m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61531216
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.11e-173MYB_related family protein
Publications ? help Back to Top
  1. Gómez-Zambrano Á, et al.
    Arabidopsis SWC4 Binds DNA and Recruits the SWR1 Complex to Modulate Histone H2A.Z Deposition at Key Regulatory Genes.
    Mol Plant, 2018. 11(6): p. 815-832
    [PMID:29604400]