PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G111800.1.p
Common NameLOC101757925, SETIT_022796mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 301aa    MW: 31824.9 Da    PI: 10.6188
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G111800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.71.6e-14128172347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE+  ++ +  +lG+g+W+ I+r++ ++Rt+ q+ s+ qky
  Seita.3G111800.1.p 128 PWTEEEHRMFLAGLDKLGKGDWRGISRHFVTTRTPTQVASHAQKY 172
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.68318IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.988121177IPR017930Myb domain
SuperFamilySSF466891.29E-18122178IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-18124176IPR006447Myb domain, plants
SMARTSM007171.9E-11125175IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-11125171IPR009057Homeodomain-like
PfamPF002491.0E-11128172IPR001005SANT/Myb domain
CDDcd001677.79E-10128173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MARKCSSCGN NGHNSRTCSG YRGHENSIST SSNSSGNTSC GGLRLFGVQL QVGSHPLKKC  60
LSMECLSPAA YYGAAAAAAA AAASSLSPSV SSSSSSLVSI EENSERVSSG YMSDGLMGRV  120
QERKKGVPWT EEEHRMFLAG LDKLGKGDWR GISRHFVTTR TPTQVASHAQ KYFLRQNSLT  180
QKKRRSSLFD AVEGAKKVAM PRIASVSGLP FPSLSPRSVD ARTNGAVVLP PFLNLMSSKS  240
PFAGGGGASQ SQHPSSLNLM AKPQAQLQMP DLELKMSTSR LSDQPGSSRS TPFFGTVRVT  300
*
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.3G111800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960912.10.0transcription factor MYBS3
TrEMBLK3Z8C60.0K3Z8C6_SETIT; Uncharacterized protein
STRINGSi022796m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42313873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-46MYB_related family protein