PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G098800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MIKC_MADS
Protein Properties Length: 216aa    MW: 24664.2 Da    PI: 9.6823
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G098800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF762.8e-241056248
                        ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
              SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                        rien   r vtf+kRr+g+lKKA ELSvLC+a+v viifsstg++++
  Seita.3G098800.1.p 10 RIENPVHRRVTFCKRREGLLKKARELSVLCGADVGVIIFSSTGRVHD 56
                        8*******************************************997 PP

2K-box29.43.3e-1181168997
               K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                          +++ ++  +q  + L+ ei  L +   +  Ge+ e ++l  L+ Le+ Le    + Rs+K++++ ++i+ lq+ke  l+++n+ L++k
  Seita.3G098800.1.p  81 SKNQRSQVTEQWTSLLRHEIGLLHHG-LRSTGEGAEGMKLDRLHALEKGLELWYYQTRSTKMQIMQQEIHILQNKESLLKSANEILQQK 168
                         4455566677888999*******999.6678********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.188161IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-24323IPR002100Transcription factor, MADS-box
CDDcd002653.55E-35378No hitNo description
SuperFamilySSF554554.84E-27388IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003195.1E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004048.4E-243859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.64479175IPR002487Transcription factor, K-box
PfamPF014863.7E-1283168IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
MVRGKVQMRR IENPVHRRVT FCKRREGLLK KARELSVLCG ADVGVIIFSS TGRVHDLATN  60
GNMQSLVERY QSITARGQME SKNQRSQVTE QWTSLLRHEI GLLHHGLRST GEGAEGMKLD  120
RLHALEKGLE LWYYQTRSTK MQIMQQEIHI LQNKESLLKS ANEILQQKEG ILKAANEILQ  180
NKVNEQNQFM NNCSFFSGSP YSTHYDANES CLFTI*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.3G098800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025807982.11e-139MADS-box transcription factor 33-like isoform X1
SwissprotQ2QW553e-81MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A368QDE71e-158A0A368QDE7_SETIT; Uncharacterized protein
STRINGPavir.Ca00337.1.p1e-89(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.12e-44AGAMOUS-like 12