PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G302300.1.p
Common NameSETIT_032927mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 365aa    MW: 41209.4 Da    PI: 7.4573
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G302300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.71.1e-1298144147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +++WT eE+ +++++v+ lG g+Wk I++++   Rt+ q+ s+ qky
  Seita.2G302300.1.p  98 KQSWTCEEHRQFLNGVNCLGRGSWKFISKYFVPSRTPAQLASHAQKY 144
                         789*****************************9*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.4E-1290152IPR009057Homeodomain-like
PROSITE profilePS5129416.56493149IPR017930Myb domain
SuperFamilySSF466892.44E-1594150IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-1396147IPR006447Myb domain, plants
SMARTSM007171.5E-797147IPR001005SANT/Myb domain
PfamPF002497.0E-1098144IPR001005SANT/Myb domain
CDDcd001675.64E-7100145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MEALAKRFPA KSIQQLGKKY AEAFEDMLCG ETDDEQSRDD ATTDWHDWYK LLQRDKNGLV  60
LGPLVETPLF EPPEQLLFKP EDHVEIQESH CKSSRKRKQS WTCEEHRQFL NGVNCLGRGS  120
WKFISKYFVP SRTPAQLASH AQKYFDRIKK NELDDTRQRH SVNDIRLVDH GTNITAHSYT  180
EVGKGKGIAS SIPPPILTEN IDILHGLAQG MTKFGQASDS QSNLIGQMTH NNQIASSIPP  240
PILTEDIDIM HGLPQGMPEF EQASNSPSKI AEQMTHNNHM LESVQWEVSS TPSPREHESV  300
LLDQTSAQNR ACPSWKRSIS AATNKRRRNN KTIPPGVLTA QRNPPSYEIV PIKRHNLQQI  360
VPPF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19398SRKRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.2G302300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804405.11e-161transcription factor DIVARICATA-like
TrEMBLA0A368Q6J60.0A0A368Q6J6_SETIT; Uncharacterized protein
STRINGSi032927m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1975668
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.15e-19MYB_related family protein