PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G236800.1.p
Common NameLOC101784380, SETIT_030822mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family HD-ZIP
Protein Properties Length: 266aa    MW: 28604.7 Da    PI: 4.5512
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G236800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.2e-1947100356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++++eq+++Le+ Fe ++++  e++++LA+ lgL+ rqV vWFqNrRa++k
  Seita.2G236800.1.p  47 KKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWK 100
                         45689************************************************9 PP

2HD-ZIP_I/II1352.6e-4346138193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls+eqv++LE+sFe e+kLeperK++lar+LglqprqvavWFqnrRAR+ktkqlE+dy+aL+++ydal++++++L++++++L +e+
  Seita.2G236800.1.p  46 EKKRRLSAEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRARWKTKQLERDYAALRHSYDALRHDHDALRRDKDALVAEI 136
                         69***************************************************************************************99 PP

         HD-ZIP_I/II  92 ke 93 
                         ke
  Seita.2G236800.1.p 137 KE 138
                         87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.36E-2038104IPR009057Homeodomain-like
PROSITE profilePS5007117.47542102IPR001356Homeobox domain
SMARTSM003891.5E-1845106IPR001356Homeobox domain
CDDcd000868.43E-1947103No hitNo description
PfamPF000461.5E-1647100IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-2048109IPR009057Homeodomain-like
PRINTSPR000318.8E-67382IPR000047Helix-turn-helix motif
PROSITE patternPS00027077100IPR017970Homeobox, conserved site
PRINTSPR000318.8E-68298IPR000047Helix-turn-helix motif
PfamPF021838.3E-18102143IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MKRPRGGSPS LLPVANPDDD GYGAAGMMEA EGDAEEEMMA CGGGGEKKRR LSAEQVRALE  60
RSFEVENKLE PERKARLARD LGLQPRQVAV WFQNRRARWK TKQLERDYAA LRHSYDALRH  120
DHDALRRDKD ALVAEIKELK AKLGDEEAAA SFTSVKAEPA ASDGPPAAGV GSSESDSSAV  180
LNDADALVTE APVPEVQGTL LPTPAAAAGA GAAGNHGGVF FHGNFLKVEE DETGFLDDDE  240
PCGGFFAVEQ PPPMAWWTEP TEHWN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17177ERKARLA
294102RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0553740.0BT055374.1 Zea mays full-length cDNA clone ZM_BFb0091J03 mRNA, complete cds.
GenBankBT0390620.0BT039062.1 Zea mays full-length cDNA clone ZM_BFb0367N11 mRNA, complete cds.
GenBankBT0342570.0BT034257.1 Zea mays full-length cDNA clone ZM_BFc0009H14 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957072.10.0PREDICTED: homeobox-leucine zipper protein HOX4-like
SwissprotQ6K4981e-134HOX4_ORYSJ; Homeobox-leucine zipper protein HOX4
SwissprotQ9XH371e-134HOX4_ORYSI; Homeobox-leucine zipper protein HOX4
TrEMBLK3ZW400.0K3ZW40_SETIT; Uncharacterized protein
STRINGSi030822m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30093482
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-54homeobox protein 16
Publications ? help Back to Top
  1. Zhao JL, et al.
    Micro-trichome as a class I homeodomain-leucine zipper gene regulates multicellular trichome development in Cucumis sativus.
    J Integr Plant Biol, 2015. 57(11): p. 925-35
    [PMID:25735194]