PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G111200.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family BBR-BPC
Protein Properties Length: 366aa    MW: 39976.3 Da    PI: 10.3478
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G111200.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind339.58.2e-10413411301
           GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssia.erdaki.........rernlalsekkaavaerd...................mafl 61 
                         mdddg+ + rn+g+y+    +k nlglqlmss++ +rd+k          ++ +++  ++ +++++rd                   m+f 
  Seita.2G111200.3.p   1 MDDDGNLSiRNWGFYDT---MKGNLGLQLMSSVPaDRDTKSllptsaflqHHGHHNAPHQLHSHHSRDsgggggasgsmptephsihMDFS 88 
                         9**************86...5************99*****999999999977788888889999*************************** PP

           GAGA_bind  62 qrdkalaernkalverdnkllalllvensla.................salpvgvqvlsgtksidslqqlsepqledsave..lreeekle 133
                         +++++l+   ++ ++r++k+l+  +v  +                   +++p+g+++++++ ++ ++ q   pql  +++e    +e+++ 
  Seita.2G111200.3.p  89 RNEAWLHP-SHHQHPREQKVLHARPVGPAGHvghpghgghpghgghavHHHPTGYGMMPDAPHTLQMMQ---PQLPSQPQEppPCKEDHVP 175
                         ********.9999***********99988778999************99*********99877655544...3333333222245677788 PP

           GAGA_bind 134 alpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYk 224
                         ++p+e++  + ++++ +kkrq++++pk++k kk+kk +++++++ + +++ +r + ++k++++v+ng++lD s++P+PvCsCtGa++qCY+
  Seita.2G111200.3.p 176 TPPVEDHSVV-RTEPPVKKRQQGRQPKSPKPKKPKK-PAVPREDGAVNGHAPRGRGPRKTVGMVINGIELDLSNIPTPVCSCTGAPQQCYR 264
                         9998886555.55566677*****************.99**********99**************************************** PP

           GAGA_bind 225 WGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDLkdhWAkHGtnkfvtir 301
                         WG+GGWqSaCCtt+iS+yPLP+++krrgaRiagrKmSqgafkk+LekL +eGy+l+np+DLk++WAkHGtnkfv ir
  Seita.2G111200.3.p 265 WGAGGWQSACCTTSISTYPLPMNAKRRGARIAGRKMSQGAFKKVLEKLVGEGYNLANPIDLKTFWAKHGTNKFVVIR 341
                         ***************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF062171.2E-1181341IPR010409GAGA-binding transcriptional activator
SMARTSM012264.3E-1791341IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0050793Biological Processregulation of developmental process
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MDDDGNLSIR NWGFYDTMKG NLGLQLMSSV PADRDTKSLL PTSAFLQHHG HHNAPHQLHS  60
HHSRDSGGGG GASGSMPTEP HSIHMDFSRN EAWLHPSHHQ HPREQKVLHA RPVGPAGHVG  120
HPGHGGHPGH GGHAVHHHPT GYGMMPDAPH TLQMMQPQLP SQPQEPPPCK EDHVPTPPVE  180
DHSVVRTEPP VKKRQQGRQP KSPKPKKPKK PAVPREDGAV NGHAPRGRGP RKTVGMVING  240
IELDLSNIPT PVCSCTGAPQ QCYRWGAGGW QSACCTTSIS TYPLPMNAKR RGARIAGRKM  300
SQGAFKKVLE KLVGEGYNLA NPIDLKTFWA KHGTNKFVVI RFGYRLDRSR FVSLTLQVVV  360
YNNSL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00253DAPTransfer from AT2G01930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012699427.10.0PREDICTED: protein Barley B recombinant-like
RefseqXP_004956022.10.0PREDICTED: protein Barley B recombinant-like
SwissprotQ8GUC31e-149BBR_HORVU; Protein Barley B recombinant
TrEMBLK3ZSA00.0K3ZSA0_SETIT; Uncharacterized protein
STRINGSi029480m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.32e-50basic pentacysteine 2