PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.2G103800.1.p
Common NameLOC101769431, SETIT_032172mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 311aa    MW: 34942.8 Da    PI: 5.6501
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.2G103800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.24.3e-14139185147
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         r  WT+eE+ +++ + +++G g Wk I+r++ ++Rt+ q+ s+ qky
  Seita.2G103800.1.p 139 RSFWTKEEHRQFLYGLRKYGRGKWKDISREFVTTRTPVQVSSHAQKY 185
                         567*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.595134190IPR017930Myb domain
SMARTSM007173.9E-12138188IPR001005SANT/Myb domain
SuperFamilySSF466893.66E-16138191IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-14139189IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.8E-11139187IPR009057Homeodomain-like
CDDcd001679.79E-10142186No hitNo description
PfamPF002492.7E-10142185IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MDPKFNGEWS ASDIKMVKSL IASHNPNNNY ADGMNKKHND IVNDIQVWFP WKERHQVIEL  60
YVELVVEMIS LTQSGNQSVV AIDNLVSDNS GILVGNPSID NMDMSFANMK GKTPEATRMV  120
DEVPQRKAIV PQQGGWHNRS FWTKEEHRQF LYGLRKYGRG KWKDISREFV TTRTPVQVSS  180
HAQKYFRRQN NSEKQRYSIN DVSLYDAEPW AQNNSSNWEA PAFAGGAYNP NYYGSGSQVA  240
TMNNLAQVWP PFMYSADQAS SSQATTWTGQ QMGPSSSAAL ALEGAGSQMA WTGDQEGDIL  300
PEQWMNIDNV *
Cis-element ? help Back to Top
SourceLink
PlantRegMapSeita.2G103800.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004959144.10.0transcription factor SRM1
TrEMBLK3ZZY70.0K3ZZY7_SETIT; Uncharacterized protein
STRINGSi032172m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10580.21e-25MYB_related family protein